SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134100002|ref|YP_001105663.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134100002|ref|YP_001105663.1|
Domain Number 1 Region: 1-56,89-423
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.08e-78
Family Gtf glycosyltransferase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134100002|ref|YP_001105663.1|
Sequence length 437
Comment hypothetical protein SACE_3464 [Saccharopolyspora erythraea NRRL 2338]
Sequence
MRVLFTTFPIPSHLHLLAPLAWALRAAGHEVGVAGQPETARAIQQAGLTAVPVGAELDFA
ARHAEVAFEDTVYASGFDIAEQRPEVLTPRYLHGLFTTYIHGPLALDALMPDALLHDLAA
FTRWWRPDLVVWDALTYAGSVVAKATGTAHARLLSGVDNLARLRALFLGSRDGEPAGDPV
ADWLGGKLARFGCDFDEEAVVGQLTIDPLPSWVCPDLDLLRLPMRPVPYHGPSSVPDWLR
EPPARTRVCLTLGMSGRSQVRDGSHVPGMAGYDLPVADLLEAVSTLDAEVVATLTADQLG
PVPVPANVRLVDFVPLDALLPTCSAVVHHGGAGTMNTALVHAVPQLVVPTAIWDERQLAA
ALSEQGAGLTCLPEDLSPRVLCERIGRLLDEPSFAANAARLAEEVEATPSPHDIVPALED
LAAAGGRTSAATRTAPV
Download sequence
Identical sequences A4FFB3
gi|134100002|ref|YP_001105663.1| 405948.SACE_3464 WP_009942273.1.58781 WP_009942273.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]