SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134101003|ref|YP_001106664.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134101003|ref|YP_001106664.1|
Domain Number 1 Region: 2-397
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.81e-76
Family Gtf glycosyltransferase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134101003|ref|YP_001106664.1|
Sequence length 403
Comment glycosyltransferase; macrolide glycosyltransferase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MPAAGHVNPSLPIVRELTSRGVEVAYYTSDEFRSAVEDTGCEFRAYPAGALGSADIAKAT
RTGGPVRVVARILKATETLLPFLLSETKSERPDAIVFDSNAIWGRMAAASLGLPMISLMT
TIMVGGKDFSTLTAREWLHFLREALPGVPAARSAKRRVVQRFGKQPYPPAPSLPMRGDLT
IFPVPSWMQSPNARLDEHCRFVGPTISAESRDHRLDPELAAFVDGPEPLTLVSLGTLHTG
SEAFFRACFEAQAALPTRVVLTVGSHTDPAKLGPPPSNTLIRTSVPQLDVLRRADVFVTH
GGMNSALEGLACGVPLVVVPQQSEQLVIGRAVADRGAGVVLRHNLSNRPVPAAELRAAVD
RALTDSSLRAAAREAGASFGEEGGAVAAADAIQDHLRARSTHR
Download sequence
Identical sequences A4FI64
405948.SACE_4470 WP_011874359.1.17192 WP_011874359.1.58781 WP_011874359.1.76288 gi|134101003|ref|YP_001106664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]