SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134102936|ref|YP_001108597.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134102936|ref|YP_001108597.1|
Domain Number 1 Region: 80-188
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000000089
Family Tetracyclin repressor-like, C-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000224
Family Tetracyclin repressor-like, N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134102936|ref|YP_001108597.1|
Sequence length 192
Comment TetR family transcriptional regulator [Saccharopolyspora erythraea NRRL 2338]
Sequence
MTSEERTPAGQRVWETARELFYREGVRSCGVAEIAEHSGVGKPSIYRNFGSKDELAVAYL
REKAVPPREILRAAQEAYPGDARAQLRRVVAEIAREITAPGHRGCPLANAVVEFPDRTHP
VREAAEALKREYLGLFRELVAPLPVGDPENLAHLIQMLVEGAHITGQIFGPDRSAANLVD
ATDRLVDSYLSD
Download sequence
Identical sequences A4FNP7
gi|134102936|ref|YP_001108597.1| 405948.SACE_6503 WP_011875062.1.17192 WP_011875062.1.58781 WP_011875062.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]