SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134103300|ref|YP_001108961.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134103300|ref|YP_001108961.1|
Domain Number 1 Region: 97-201
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.1e-35
Family N-utilization substance G protein NusG, N-terminal domain 0.0000441
Further Details:      
 
Domain Number 2 Region: 227-283
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.1e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134103300|ref|YP_001108961.1|
Sequence length 283
Comment transcriptional regulator [Saccharopolyspora erythraea NRRL 2338]
Sequence
MTSHEGQELTGPTDEQAPAADSTADSVDAVETTDAGEAVAGEQAAEDSAGEAAESADEQA
ADDESGDEAEAEETDEEAEEADPVEELRAALRRAPGEWYVVHSYAGYENKVKTNLETRAQ
TLDVEDYIFQVEVPTEEVTEIKNGQRKLVQRKVLPGYILVRMELNDASWSAVRNTPGVTG
FIGATSHPSPLSIDDVLKFLAPRAEKEAKPEAGKKAAAPAAAKPSVEVDFEVGESITVMD
GPFATLPATISEVNADAQKLKVLVSIFGRETPVELSFNQVSKI
Download sequence
Identical sequences A4FPR1
gi|134103300|ref|YP_001108961.1| 405948.SACE_6872 WP_009944085.1.17192 WP_009944085.1.58781 WP_009944085.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]