SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226354958|ref|YP_002784698.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226354958|ref|YP_002784698.1|
Domain Number 1 Region: 6-191,359-446
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.06e-53
Family Bacterial dinuclear zinc exopeptidases 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|226354958|ref|YP_002784698.1|
Domain Number - Region: 207-244,290-342
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0241
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226354958|ref|YP_002784698.1|
Sequence length 451
Comment peptidase M20 [Deinococcus deserti VCD115]
Sequence
MTQADLSSHIERGLSDLRNLVALQSVSAQGRMLPETAAFVTGLLEAEGFTVREVPGDVAP
VLIAEAGPADAPATLLIYNHYDVQPEDPLELWDTPPFELTEREGRLYGRGASDDKGEFAS
RLAAVRAVKDRHGGQLPVRVRWLIEGEEEVGSPSLERVVREQAASLQADGCWWEFGSISE
DGRPVAFLGLKGVMCLELRARVADSDLHSSLGAVVDNPLYRLARAVASLRDDTGRVTIPG
FLDDLLPVSPADEAAIAAVPGQGETTLATYGITRPLGAPGEYHRRLNLAPVLNVNGWGGG
YQGEGSKTVLPAHGFVKLDFRLVPGQTPSRVLELLRAHMDAQNLSDIEIVELEAHQHPAR
ADAGHPFVRACLDAAREAHGQEPIVNPSSGGSGPMHPFMDALDGLPCVALGIGNVGGRVH
APNENIRRADFAKGVAFGVALLERLAGGLQE
Download sequence
Identical sequences C1CYC3
546414.Deide_01380 WP_012692067.1.1337 gi|226354958|ref|YP_002784698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]