SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226355392|ref|YP_002785132.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355392|ref|YP_002785132.1|
Domain Number 1 Region: 132-176
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000687
Family Type I dockerin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226355392|ref|YP_002785132.1|
Sequence length 181
Comment hypothetical protein Deide_05400 [Deinococcus deserti VCD115]
Sequence
MKPVGPAGRRLMLLATLLCASAPANAATLKFRPQGAEMLRLLQAAVATLNTKDLPVTLDT
ASGPILTLGSTSAPFNPDVAARVVVVGSDRRIEFNPQGPLPLADALRAELTRELGLTEWT
SAAARTRLSGADLNGDGKIDLTDLALLMNNYGKTDTTVGDLNQDRKVDDADLRLFSSQYR
P
Download sequence
Identical sequences C1D0K4
546414.Deide_05400 gi|226355392|ref|YP_002785132.1| WP_012692501.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]