SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226355534|ref|YP_002785274.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355534|ref|YP_002785274.1|
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-38
Family Type II thymidine kinase 0.0000305
Further Details:      
 
Domain Number 2 Region: 153-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000166
Family Type II thymidine kinase zinc finger 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226355534|ref|YP_002785274.1|
Sequence length 202
Comment thymidine kinase [Deinococcus deserti VCD115]
Sequence
MLKSPYSGGHLEVIVGPMFSGKSEELIRRVTRALIARQRVQVFKPAVDDRYHESAVASHA
GRTVGALAVGDVADIRAHLSGEAPLLQASAEMPDVIGIDEVQFFGPELVPLALELADAGV
RVILAGLDLDFRAEPFGCMPDLLARAESVEKLTAICTQCGAPATRSQRLISGEPARFDDP
VVLVGALESYEARCRLHHVVTR
Download sequence
Identical sequences C1D0Z6
gi|226355534|ref|YP_002785274.1| WP_012692643.1.1337 546414.Deide_06660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]