SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226355767|ref|YP_002785507.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226355767|ref|YP_002785507.1|
Domain Number 1 Region: 267-336,364-439
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000000000000011
Family N-acetylmuramoyl-L-alanine amidase-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226355767|ref|YP_002785507.1|
Sequence length 456
Comment cell wall hydrolase/autolysin [Deinococcus deserti VCD115]
Sequence
MALWPLLPAAVLGIGLLGAGLAEAQIALSKLTLAGKQVQSVNLYGAEYASQETLSALLNV
SRDGALLRVTGLGHTLLLPIDEDQQRATTDFNTVQLDTRRVRARTATLINGNVYLPLDTL
ARGLGATYETGKFRVAAPTLQGVSSRAGKDADRLVLDLSRDVEVIDEQRGAKVVVTLRGL
KGEPRKYTTRGAFVPRAEVTREKDNLVLSFPLTAASGVRVFKVVRPGSVRVVVDAGPGIE
RTSPVLLQHVTRPLIVIDPMRVEGVGRDVTLEVARRAAELLSGAGWQVRVTRDSASAMNL
GTKLQLARQSDVFLALDLGRLPGAKRSGVTVYEQSGESSAQIVNAIRAGNAPPYGALVAG
NSGGTRKLGELLRGELKGGGVMAKQDTTSRVLTLREAPQAALLMELGWASSAEDLARLAV
DRRLQAMANALARSVATYLTARANNNASLGAQGVER
Download sequence
Identical sequences C1D1M9
WP_012692876.1.1337 gi|226355767|ref|YP_002785507.1| 546414.Deide_08780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]