SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226356386|ref|YP_002786126.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356386|ref|YP_002786126.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.38e-22
Family FGase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226356386|ref|YP_002786126.1|
Sequence length 262
Comment N-formylglutamate amidohydrolase [Deinococcus deserti VCD115]
Sequence
MTQARDALLVLTPHPSGALPADVLRDMLGEEMFDTPRREALLRAVFLDGDAYTELIYHVP
GARHLQASWSRFAADLNRDRSDESDNGVLKRTGFDREPLYPAGFEFDPAAREARLRRIWD
PFDAQVRSELPGTRLMIVGHSMAPYGPALGPDTGTPRPALCLMPGTPAAPTFPTELWEPL
RRACQEAFSDAVAGSPDPRVTIGEPWSTDTLSLTHQRHSGVPAFGIEINAGLFLKDEQPQ
DHALRALNAAFSRFADAALALI
Download sequence
Identical sequences C1CW05
gi|226356386|ref|YP_002786126.1| WP_012693495.1.1337 546414.Deide_14240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]