SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226356620|ref|YP_002786360.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356620|ref|YP_002786360.1|
Domain Number 1 Region: 11-194,365-451
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.11e-61
Family Bacterial dinuclear zinc exopeptidases 0.001
Further Details:      
 
Domain Number 2 Region: 194-240,297-361
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000293
Family Bacterial exopeptidase dimerisation domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226356620|ref|YP_002786360.1|
Sequence length 454
Comment Succinyl-diaminopimelate desuccinylase [Deinococcus deserti VCD115]
Sequence
MTNPDLATLLNREQAQEELFDLLRIPSVSADPAYKAEVVRAAEWLQRKLSTLGFTARVDQ
TPGHPLVYAERLTDPAQPTVLIYGHYDVQPEAPLEEWLTPPFEPTVRDGRIYARGSTDDK
GQAFAHVKGVELLLSQGELPVNVKFLLEGEEEIGSPSIIPYLQAHKDELKADVIVISDGS
RFAPDVPTITYGVRGLSYVEIHVQGANRDLHSGSYGGAAPNPINALCEIIARLKDEQGRV
TIPGFYDGVEELTEQERAMWASLPHSDEEFAASIGVPALPGEEGYSVLERIWGRPTLDVN
GIWGGYQGEGSKTVIAAKAGAKVSMRLVPGQDPDRITQLIKEYVPQIAPAGVKAEVRGHH
GGQPVKFKTDSPAIQAANRALHRVYGRDAVFARTGGSIPIVAAFSDILKTEVLFVDFGLN
EDAPHSPNESFALQDYHNGILTSAYLLQELAQSS
Download sequence
Identical sequences C1CWN9
WP_012693729.1.1337 gi|226356620|ref|YP_002786360.1| 546414.Deide_16370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]