SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226356684|ref|YP_002786424.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356684|ref|YP_002786424.1|
Domain Number 1 Region: 155-254,300-377
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.34e-44
Family N-acetylmuramoyl-L-alanine amidase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226356684|ref|YP_002786424.1|
Sequence length 379
Comment N-acetylmuramoyl-L-alanine amidase [Deinococcus deserti VCD115]
Sequence
MSRMLLCTLLTGALLVPGAQAAPRVGSHDGFTRVVFDLPASAKSSVKVQGQSITVQLNVS
LKAEQGPLNASGVTAYAVAGKTVTVTLARGHTQAKASVLPASGSQNARLVIDVPTSAAAS
KVPATPNSQGTRTPVAVARPASTAPAPAAKPAVRPRVVLDAGHGGKDPGAQSPWTSEEEV
TLDIALRTRAELVKHGVDVVMVRESDRHLSVNKSQDLEARSRLAKNGTVSAFVSIHVNAA
GPGAQGIETFYFGQPMAGRNRSLAVQENGGGTVGEALTRQASTSAQNMLGDILAQAKIAF
SRDLAHKVQSRLIAATGAVNRGVQTDAFYVISNPTTPAILVEVGFGSSPVEGPKLAQAAY
RERISQALARAILDFLNTK
Download sequence
Identical sequences C1CWV3
gi|226356684|ref|YP_002786424.1| WP_012693792.1.1337 546414.Deide_16990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]