SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226356730|ref|YP_002786470.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356730|ref|YP_002786470.1|
Domain Number 1 Region: 7-79,166-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.11e-54
Family Bacterial dinuclear zinc exopeptidases 0.00017
Further Details:      
 
Domain Number 2 Region: 69-174
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 6.41e-23
Family Aminopeptidase/glucanase lid domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226356730|ref|YP_002786470.1|
Sequence length 349
Comment bifunctional peptidase M42/cellulase [Deinococcus deserti VCD115]
Sequence
MSKINQEFLFALLREAAPSGFERRAADVWLKEAATFARTSEDHYGNVYAELGPEGAPAII
LTGHLDEIGLMVSHVNDQGFLHVLPLGGWDPQVLVGQRIRLLAPEGDLIGVIGKKAIHVM
DEDDRNKASKLEDLWIDVDMTAEDARKRIPVGTVAVIEQPTVMVGNKIVSRALDNRVGGF
IVLEALRALKDADLKHRIVAVGTSQEEIGSYGSKTAAHRVRPIAGVAVDVTHETTQPGVK
AEKYGVVPFGSGANLTVGAMVSPVIFRQMKEAAEREGIPHSVSASPRLTFTDADTMMLSR
EGVPGAVVSIPNRYMHSPNEMVDAGDVKACIDILAAWVRGLEAEGSFLR
Download sequence
Identical sequences C1CWZ9
WP_012693838.1.1337 gi|226356730|ref|YP_002786470.1| 546414.Deide_17450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]