SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226356743|ref|YP_002786483.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226356743|ref|YP_002786483.1|
Domain Number 1 Region: 126-436
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.4e-97
Family Leucine aminopeptidase, C-terminal domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 41-115
Classification Level Classification E-value
Superfamily Macro domain-like 0.000000388
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226356743|ref|YP_002786483.1|
Sequence length 440
Comment leucyl aminopeptidase [Deinococcus deserti VCD115]
Sequence
MEHSELSVVFSGEAFPGRLTRGLKPGEVRLAARTAQGDEALALLPSDTTQARELGAAIAK
LARDLKVTAVRVAPTDHAQALASAALAAGWQDTRFKGDDAEQARVPTLEMTGLKAEAQAA
VEALSAGLSLARELVSAPANVINPATLAREARLLEAFGLDVDVWDGAEIEARGMGLLAAV
AAGSVTGPRLIRVTLPARGEVTRVVALVGKGITFDTGGYSIKTTQGMYGMKNDMGGAGAV
LGAMRALADLKDRIPQGVEVRAYVAAAENMVGPHAMRPGDVYRAANGKTVEIVSTDAEGR
LVLGDALAVACDEGATELVDVATLTGVKISALGNDIAAVFSNDRALADRLRAAAHEAGEH
IWELPLHAPYLKAYQKNTVADLKNSDLNPAGASIKAALFLSQFVTRPWAHLDIAGNAEKE
GVATGWGVGTLVEYVLGQPQ
Download sequence
Identical sequences 546414.Deide_17560 gi|226356743|ref|YP_002786483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]