SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226357780|ref|YP_002787520.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226357780|ref|YP_002787520.1|
Domain Number 1 Region: 308-512
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.96e-22
Family Pancreatic carboxypeptidases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226357780|ref|YP_002787520.1|
Sequence length 602
Comment hypothetical protein Deide_3p00810 [Deinococcus deserti VCD115]
Sequence
MELLSALRLAHQPHHVLAYVSESPQTRAALRTSIVRAAGPGCAARVRSAYKTAYFWITEE
VQPLWRRAQADRVTLTYPVLSEAPQGRFLQEAYPLAAVFEREGVEAEFVPGPVGRPYYQA
TLWRGERELWHGTCFTPLFQRQAPDGRMVLGPTGWLTVQAEGADVLDQRLETDGEAFWDW
YVATVLPAVLELADRRDDGLVFRNLAVTLQLSEPDLALDVLDERISMTEALTEEVYFGTV
DALKRHTSTPPGARTLTPGRIVPVAHAVPGQDGWARVTLTEWASSPAELHRPGASHSVTA
DPESVLQDRPAPPGQIWANARAAADRHQLEWHVPAHSVDGRPVPAVLRSTPGAAGSVLIT
AGQHANETTGPVAALNLLSHLAGMPVNFALLPLENPDGAFLHRALTQLAPNHMHHAARYT
SLGDDLEARLRQGDRRWEAGARAWAQEQVGANLHLNLHGYPAHEWVRPYSGYAPHGFESW
ALPAGFITIVWYWPGHDKPARLLAEAIAQRLQQEPEVVQHAQAALRASTAHVLTPHYELI
GGLPFILTEQPSALCPLTVITEAPDETIYGARFRSCVQAHLSVCLAAIGHTLRGDGQPES
CT
Download sequence
Identical sequences gi|226357780|ref|YP_002787520.1|NC_012528 gi|226357780|ref|YP_002787520.1| 546414.Deide_3p00810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]