SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226358210|ref|YP_002787949.1| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226358210|ref|YP_002787949.1|
Domain Number 1 Region: 3-193,293-322,368-434
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.32e-50
Family Bacterial dinuclear zinc exopeptidases 0.002
Further Details:      
 
Domain Number 2 Region: 183-287
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 8.2e-18
Family Bacterial exopeptidase dimerisation domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226358210|ref|YP_002787949.1|
Sequence length 471
Comment aminobenzoyl-glutamate utilization protein B [Deinococcus deserti VCD115]
Sequence
MNTWAEHHLPELTKLATEIWHHAELRYEEMQSMQAQQRVLRDAGFELTTGVAGIPTAFSA
QVGSHGPVVALLGEYDALSGLSQRAGVAVPDPLHPGGNGHGCGHHLLGTAALGAVLVLRD
YLQASGQPGIVRYYGCPAEEGGSGKTFMVREGVFDDVSFALTWHPATTNTLFPGRSLANI
QCAFHFSGIAAHASAAPHLGRSALDAVELMNIGANYLREHLPPAAKLHYAVTNTGGTSPN
VVQAEAEVLYLMRAVDDQATRAVFDRVQDVARGAALMTGTRLTLKFEKACSSFQANQALS
EVVSRILGQVGAPTFDDADEVFAAQIQATLPPEAIQGDRQVLRSGKSSAVFARDVIPYSA
EKAQELLPGSTDVADVSWVAPTAQFMAACYALGTQAHSWQQVAQGLEPAAFKGMLQAVKV
LAGTAITVLEDPELLAQIREEHATRRAEVPYVSPIPADVLPPVNRTFEGQG
Download sequence
Identical sequences C1D358
gi|226358210|ref|YP_002787949.1|NC_012529 gi|226358210|ref|YP_002787949.1| 546414.Deide_2p01760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]