SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|355004648|ref|YP_002787391.2| from Deinococcus deserti VCD115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|355004648|ref|YP_002787391.2|
Domain Number 1 Region: 3-181,301-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.71e-55
Family Bacterial dinuclear zinc exopeptidases 0.0023
Further Details:      
 
Domain Number 2 Region: 172-291
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.33e-19
Family Bacterial exopeptidase dimerisation domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|355004648|ref|YP_002787391.2|
Sequence length 377
Comment acetylornithine deacetylase [Deinococcus deserti VCD115]
Sequence
MTQSLQDLLAALVRINSINPSLVPGAAGEAELATFVAGWLQDHGIEAVIDEAAPGRLSVI
GTVRGTGGGRSLLLNAHLDTVGTDHMPEAFNPVVRDGRMYGRGTYDMKGGLAACLFALLD
AREAGLRGDVILAAVADEEHASLGMQSVLKTVRADAAIVTEPTSLQLCVAHKGFTWHEIT
THGRAAHGSRPDLGTDAIAHMGRVLVRLEALQRELEERPPHPLLGHASVHASLITGGQEL
SSYPERCTLQIERRTLPGETRDEVEQEWTALLGELAQDPQFHAEHRITLLREPFGVSEEA
PIVQVLHAQAAQVLGEAPQHIGQTFWMDAAFLAGAGIPTVVFGPHGTGAHATEEWVDLAS
VEQCRAVLSATVRAFCA
Download sequence
Identical sequences C1D2J8
WP_012694760.1.1337 gi|355004648|ref|YP_002787391.2|NC_012527 gi|355004648|ref|YP_002787391.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]