SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253701710|ref|YP_003022899.1| from Geobacter sp. M21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253701710|ref|YP_003022899.1|
Domain Number 1 Region: 45-70,232-275
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000167
Family Photosynthetic reaction centre (cytochrome subunit) 0.051
Further Details:      
 
Domain Number 2 Region: 31-75,125-188,221-274
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000075
Family Di-heme elbow motif 0.037
Further Details:      
 
Weak hits

Sequence:  gi|253701710|ref|YP_003022899.1|
Domain Number - Region: 63-134
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0183
Family Integrin alpha N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253701710|ref|YP_003022899.1|
Sequence length 276
Comment hypothetical protein GM21_3113 [Geobacter sp. M21]
Sequence
MKKQLITVLALAGIAAGATLAFATEGSHGGGILKSKHDMNMYVGTHGGKLDKDQRVCAYC
HTPHHSVGIGSTAMVDIDKDGLADLDVNGQETTYEVYYPLWSRALNPTATIDGYVSQTFN
PTGKFYDPLAGPSRLCMTCHDGTIAADSYYGETAGTANAGDDQLMMWSMGNFGIGKGDSL
SNDHPVGFVYKDMADDDTNYEIKDQSSSFVGTTKTIDSALTNIDGVGKVMTCASCHDVHN
GTAVQNKPLAAGESGRGYFLLAAQKDSAICLSCHDK
Download sequence
Identical sequences C6E3E9
WP_015838357.1.50895 443144.GM21_3113 gi|253701710|ref|YP_003022899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]