SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253700434|ref|YP_003021623.1| from Geobacter sp. M21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253700434|ref|YP_003021623.1|
Domain Number 1 Region: 447-621
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-37
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 269-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-29
Family Flavin-binding PAS domain 0.0059
Further Details:      
 
Domain Number 3 Region: 5-161
Classification Level Classification E-value
Superfamily CheY-like 2.99e-26
Family CheY-related 0.0028
Further Details:      
 
Domain Number 4 Region: 641-758
Classification Level Classification E-value
Superfamily CheY-like 1.99e-24
Family CheY-related 0.0021
Further Details:      
 
Domain Number 5 Region: 128-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.064
Further Details:      
 
Domain Number 6 Region: 382-454
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000981
Family Homodimeric domain of signal transducing histidine kinase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253700434|ref|YP_003021623.1|
Sequence length 773
Comment PAS/PAC sensor hybrid histidine kinase [Geobacter sp. M21]
Sequence
MKHALRILIVDDSPEDAALIVRQLQREFSVSYERVETPDEMESALDKGGWHIVISDYVMP
KFSGLAALKLLHDRGMELPFIMVSGQMGEDAAVEAMRAGAHDYLLKDRLSRLIPAIKREL
NDAVVRRERRMAEEALSATEARFHSLVEQSLVGIFMLQDDIFIYVNPKFGEIFAYEPQQL
IESRSLLELVAPEDQIKVMTRFLRPLMEGNDSLHYFFRGKRRDGSLIDLEVNGTRTRVNG
SAAIIGTLLDITERKHAEAELSKLWRAVEQSPVSVVITDLFGRIEYVNPKFIEVTGYTEE
ELIGKNPNILKSGMTDAKVYEELWSTITSGREWHGELHNKKKNGELFWESGHISAIKNAE
GQITHFVGVKEDVTERKLAIEQLRQVQKMEAIGRLAGGIAHDFNNLLTVINGYSTLLVRS
LDKGSPTHKEAEQILRAGERAADLTRQLLSFSRRQIMEPRVLNINKQVRAVQKMLERLIG
EHIGLVTTLSEDAGFVKMDPGQMEQIVMNLIVNARDASETGAVIAMSTDNVDLDQNFSHL
HPGSVPGSYVRLSVADQGQGMTEEVKQHLFEPFFTTKEMGRGTGLGLATVYGIVKQSGGY
IEVVSEPGRGACFNIYLPRVSEPAPAPPAPPADEEIDSSHVILVVEDEPGVLNLVVHTLR
MRGFTVFEATDPDQGITLFEEHAHEIDMLLTDVVMPFMSGPALAELLISKKPGLKVLFMS
GHTDDRAGFEKILEKGMQFLPKPFASDALIRKVRDTLSEGAAKAAGAISGGSN
Download sequence
Identical sequences C6E6M4
WP_015837110.1.50895 gi|253700434|ref|YP_003021623.1| 443144.GM21_1812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]