SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|239826234|ref|YP_002948858.1| from Geobacillus sp. WCH70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239826234|ref|YP_002948858.1|
Domain Number 1 Region: 47-486
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.25e-78
Family Amylase, catalytic domain 0.00000068
Further Details:      
 
Domain Number 2 Region: 667-760
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.4e-30
Family Starch-binding domain 0.000072
Further Details:      
 
Domain Number 3 Region: 489-578
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.55e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.0004
Further Details:      
 
Domain Number 4 Region: 585-658
Classification Level Classification E-value
Superfamily E set domains 0.00000000000448
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|239826234|ref|YP_002948858.1|
Sequence length 767
Comment alpha amylase [Geobacillus sp. WCH70]
Sequence
MWKVPKFIKQSYLVFLLALLLYSSFGFSFSRTEATTSTGALGPVTPKDTIYQIVTDRFFD
GDPSNNKPPGFDPTLFDDPDGNNQGNGKDLKLYQGGDFQGIIDKIPYLKNMGITAVWISA
PYENRDTVIEDYQSDGSINRWTSFHGYHARNYFATNKHFGTMKDFIRLRDALHQNGIKLV
IDFVSNHSSRWQNPTLNFAPEDGKLYEPDKDANGNYVFDANGEPADYNGDGKVENLLADP
HNDVNGFFHGLGDRGNDTSRFGYRYKDLGSLADYSQENALVVEHLEKAAKFWKSKGIDGF
RHDATLHMNPAFVKGFKDAIDSDAGGPVTHFGEFFIGRPDPKYDEYRTFPERTGVNNLDF
EYFRAATNAFGNFSETMSSFGDMMIKTSNDYIYENQTVTFLDNHDVTRFRYIQPNDKPYH
AALAVLMTSRGIPNIYYGTEQYLMPSDSSDIAGRMFMQTSTNFDENTTAYKVIQKLSNLR
KNNEAIAYGTTEILYSTNDVLVFKRQFYDKQVIVAVNRQPDQTFTIPELDTTLPVGTYSD
VLGGLLYGSSMSVNNVNGQNKISSFTLSGGEVNVWSYNPSLGTLTPRIGDVISTMGRPGN
TVYIYGTGLGGSVTVKFGSTVATVVSNSDQMIEAIVPNTNPGIQNITVTKGSVTSNPFRY
EILSGDQVQVIFHVNATTNWGENIYVVGNIPELGSWDPNQSSEAMLNPNYPEWFLPVSVP
KGATFEFKFIKKDNNGNVIWESRSNRVFTAPNSSTGTIDTPLYFWDN
Download sequence
Identical sequences C5D6S5
471223.GWCH70_0700 gi|239826234|ref|YP_002948858.1| WP_012749393.1.59651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]