SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256820723|ref|YP_003142002.1| from Capnocytophaga ochracea DSM 7271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256820723|ref|YP_003142002.1|
Domain Number 1 Region: 81-260
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.65e-39
Family Endonuclease I 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256820723|ref|YP_003142002.1|
Sequence length 272
Comment Endonuclease I [Capnocytophaga ochracea DSM 7271]
Sequence
MKRIYVLLFVMLLLACKNDDQAQPLPAVPPAPNPPTTTTPTTEEPIPPVKITVPEELKTY
YKGFDFTKTGTALYDDLAALTIAKHKNQLGYGERHKYLYKADASLKNPQNVVLVYTGEER
FWKEYNSGSNTYKPQTFNTEHIYPQSKYKGDAKGDLHHLKACDSKLNGSRGNIPFTDGKG
KAGRTKGAWYPGDEWKGDVARMIMYINLRYHDRIDDVIVLGGLQVLLKWNDEDPVSDLER
QRNNVIEKAQGNRNPFIDFPQLVRPAYKGYKQ
Download sequence
Identical sequences C7M8R2
521097.Coch_1896 WP_015782917.1.37490 gi|256820723|ref|YP_003142002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]