SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226948035|ref|YP_002803126.1| from Clostridium botulinum A2 str. Kyoto

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226948035|ref|YP_002803126.1|
Domain Number 1 Region: 1-476
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.54e-158
Family Clostridium neurotoxins, catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 465-796
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 4.71e-120
Family Clostridium neurotoxins, "coiled-coil" domain 0.00041
Further Details:      
 
Domain Number 3 Region: 806-988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-37
Family Clostridium neurotoxins, the second last domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226948035|ref|YP_002803126.1|
Sequence length 1159
Comment botulinum neurotoxin type A2, nontoxic-nonhemagglutinin component, NTNH [Clostridium botulinum A2 str. Kyoto]
Sequence
MKINNNFNIDSLIDNRDVAIVRGRKTDTFFKVFQVAPNIWIAPERYYGESLNINEDQKSD
GGIYDSNFLSTNDEKDEFLQATVKILQRINNNVIGAKLLSLISTAIPFPYEYKPGDYRQT
NYLVSKDNQHYYTANLVIFGPGTNIVENNAIYYKKEDSENGMGTMSEIWFQPFLTYKYGQ
FYVDPALELIKCLIKSLYYLYGIKPSDDLSIPYRLRSELNSFEYSELDMIDFLISGGTEY
KLLDTNPYWFTDNYFIDAPKNFEKYKNDYETKIKNNNDIANSIKLYLEQKFKTNAQDIWE
LNLSYFSTEFEIMMPEIFNNALNHYYRKEYYVIDYFKNYNINGFINGQIKTILPLSKYNK
NIINKPELVVNLINENNTVLMKSNVYGDGLKGTMDNFYAAYKIPYNIGDEYHINYSYLNN
VNVEEINNIPPINDADIYPYRKNSDPFIPVYNITETKEINTTTPLSVNYLQAQVTNSNDI
SLSSDFSKVISSKDRSLVYSFLDNTIDYLDSIKYDEPIDTDKKYYLWLKEIFRNYSFDMT
ETQEVNTPCGINKVVPWLGKALNILNTGNSFIEEFKSLGPISLINKKENITMPKIEIDEI
PNSMLNLSFKDLSENLFNRFSKNNSYFEKIYYDFLDQWWTQYYSQYFDLICMAKKSILAQ
ETLIKKIIQKKLSYLIGNSNISSDNLALMNLTTTNTLRDISNESQIAMNNVDSFLNSAAI
CVFEGNIYSKFISFMEQCINNINKNTREFIQKCTNITENEKLQLINQNIFSSLDFDFLNI
ENLKSLFSSETALLIKEETSPYELVLYAFQEPDNNAIGDASAKNTSIEYSKDIDLVYGIN
SDALYLNGSNQSISFSNDFFENGLTNSFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYF
QDTGLVFNMIDSNGNEKNIYLSDVSNNSWHYITISVDRLKEQLLIFIDDNLVANESIKEI
LNIYSSNIISLLSENNPSYIEGLTILNKPTTSQEVLNNYFKVLNNSYIRDSNEERLEYNK
TYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINSNKQYVQKFDEVII
SILGNMEKYIDISEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENH
NWMICNNDMSKYLYLWSFK
Download sequence
Identical sequences C1FUH8 D2KKE7
gi|226948035|ref|YP_002803126.1| WP_012704905.1.14863 WP_012704905.1.16999 WP_012704905.1.27859 WP_012704905.1.32894 WP_012704905.1.36253 WP_012704905.1.45672 WP_012704905.1.46996 WP_012704905.1.57050 WP_012704905.1.69692 WP_012704905.1.70928 WP_012704905.1.77051 WP_012704905.1.87856 WP_012704905.1.90975 WP_012704905.1.94833 WP_012704905.1.95223 536232.CLM_0896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]