SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226948036|ref|YP_002803127.1| from Clostridium botulinum A2 str. Kyoto

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226948036|ref|YP_002803127.1|
Domain Number 1 Region: 2-546
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.38e-189
Family Clostridium neurotoxins, catalytic domain 0.00000000000000262
Further Details:      
 
Domain Number 2 Region: 549-874
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 3.14e-111
Family Clostridium neurotoxins, "coiled-coil" domain 0.0000000000685
Further Details:      
 
Domain Number 3 Region: 1080-1293
Classification Level Classification E-value
Superfamily STI-like 2.15e-78
Family Clostridium neurotoxins, C-terminal domain 0.000000003
Further Details:      
 
Domain Number 4 Region: 875-1079
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-49
Family Clostridium neurotoxins, the second last domain 0.0000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226948036|ref|YP_002803127.1|
Sequence length 1296
Comment bontoxilysin A [Clostridium botulinum A2 str. Kyoto]
Sequence
MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN
PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG
STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGY
GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAEHRLYGIAINPN
RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKA
KSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKV
INRKTYLNFDKAVFRINIVPDENYTIKDGFNLKGANLSTNFNGQNTEINSRNFTRLKNFT
GLFEFYKLLCVRGIIPFKTKSLDEGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLDKVEE
ITADTNIEAAEENISLDLIQQYYLTFDFDNEPENISIENLSSDIIGQLEPMPNIERFPNG
KKYELDKYTMFHYLRAQEFEHGDSRIILTNSAEEALLKPNVAYTFFSSKYVKKINKAVEA
FMFLNWAEELVYDFTDETNEVTTMDKIADITIIVPYIGPALNIGNMLSKGEFVEAIIFTG
VVAMLEFIPEYALPVFGTFAIVSYIANKVLTVQTINNALSKRNEKWDEVYKYTVTNWLAK
VNTQIDLIREKMKKALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINSA
MININKFLDQCSVSYLMNSMIPYAVKRLKDFDASVRDVLLKYIYDNRGTLVLQVDRLKDE
VNNTLSADIPFQLSKYVDNKKLLSTFTEYIKNIVNTSILSIVYKKDDLIDLSRYGAKINI
GDRVYYDSIDKNQIKLINLESSTIEVILKNAIVYNSMYENFSTSFWIKIPKYFSKINLNN
EYTIINCIENNSGWKVSLNYGEIIWTLQDNKQNIQRVVFKYSQMVNISDYINRWIFVTIT
NNRLTKSKIYINGRLIDQKPISNLGNIHASNKIMFKLDGCRDPRRYIMIKYFNLFDKELN
EKEIKDLYDSQSNSGILKDFWGNYLQYDKPYYMLNLFDPNKYVDVNNIGIRGYMYLKGPR
GSVVTTNIYLNSTLYEGTKFIIKKYASGNEDNIVRNNDRVYINVVVKNKEYRLATNASQA
GVEKILSALEIPDVGNLSQVVVMKSKDDQGIRNKCKMNLQDNNGNDIGFIGFHLYDNIAK
LVASNWYNRQVGKASRTFGCSWEFIPVDDGWGESSL
Download sequence
Identical sequences C1FUH9 Q45894 Q58GH1
gi|226948036|ref|YP_002803127.1| WP_012703873.1.14863 WP_012703873.1.15773 WP_012703873.1.16999 WP_012703873.1.18088 WP_012703873.1.2334 WP_012703873.1.27859 WP_012703873.1.32894 WP_012703873.1.36253 WP_012703873.1.42818 WP_012703873.1.45672 WP_012703873.1.46996 WP_012703873.1.51228 WP_012703873.1.5276 WP_012703873.1.57050 WP_012703873.1.59839 WP_012703873.1.67940 WP_012703873.1.69692 WP_012703873.1.70928 WP_012703873.1.77051 WP_012703873.1.79827 WP_012703873.1.87856 WP_012703873.1.90975 WP_012703873.1.9205 WP_012703873.1.93232 WP_012703873.1.94833 WP_012703873.1.95223 WP_012703873.1.96416 536232.CLM_0897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]