SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257789826|ref|YP_003180432.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257789826|ref|YP_003180432.1|
Domain Number - Region: 160-185
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0981
Family Type I dockerin domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257789826|ref|YP_003180432.1|
Sequence length 199
Comment hypothetical protein Elen_0049 [Eggerthella lenta DSM 2243]
Sequence
MARRSVLNRSFSTSEKVLMLVLAVLLVVACYYFLVVKNVADTIAANEDRLADIEISINAQ
EMLAADRARMKAELEALGEDGTLPVVAVYDNIRNELNELNALMGGATTYNLSFAQPTVED
KLVRREVTVSFTVPDYAAALDVVRKLENGTYRCEITDFSVIGDMLADGTVDSVDAVLTVT
YLETTNGAATTAGLVEKAK
Download sequence
Identical sequences A0A096LM98 C8WIS2 F0HQ86 T4B237
gi|257789826|ref|YP_003180432.1| WP_009305628.1.14381 WP_009305628.1.74853 WP_009305628.1.87427 WP_009305628.1.95410 479437.Elen_0049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]