SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790072|ref|YP_003180678.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790072|ref|YP_003180678.1|
Domain Number 1 Region: 284-424
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.29e-21
Family Oxidoreductase molybdopterin-binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 116-211
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000126
Family Cytochrome c3-like 0.032
Further Details:      
 
Domain Number 3 Region: 456-531
Classification Level Classification E-value
Superfamily E set domains 0.000000189
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257790072|ref|YP_003180678.1|
Sequence length 552
Comment molybdopterin binding oxidoreductase [Eggerthella lenta DSM 2243]
Sequence
MKRIMSGQSCSHGPSKTKVLVVLLAIALVASFAAWGCSPKAANDDAKAPEKKAESAASEK
AGDGVDELAAYSGFPTEGRFIDNVAALPGFYKNTEKNEANAKAKAPRRYTDRNGNLVQPV
PADELGWNNTYLDADKRGCTSCHTLENALMSLPTYHRLIFFGYPTEQGYQNCIACHSDSY
SGHKLADAIHTLHMNSTMFLNDDDGNCQSCHYINPDTGVFDRWDEVKYDLYKGITDVKAD
ELKASVSYDQTTVTPAENRIFKTVKDEPSQWLTDDSKQDKSIYENWVISIDGDCENPVEM
TLPEMEQQFGTVKQVMKMDCTINGVGQATIMQSEVEGIPLKAIIDYAKPKSGANVVSPIG
SDGYDYAKMGIDWLLENDAVIVTKMDGELLPNSQGYPCMIWVNKTSGGNFTKRISNLTFM
TVPDDKIDAELYVGQFTDDRTGEIYSKPNSGVLNYPTGIVLSGEEAKTVHLEGFADAWDE
PIKKMEFSFDHGETWTVVDTPDNNADNWTYWRMDFTPPAAGAYLLDIRTTSITPDGADRV
CQYDTQFMFTVE
Download sequence
Identical sequences C8WKI2 F0HL98
gi|257790072|ref|YP_003180678.1| 479437.Elen_0298 WP_009608157.1.14381 WP_009608157.1.74853 WP_009608157.1.89587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]