SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790166|ref|YP_003180772.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790166|ref|YP_003180772.1|
Domain Number 1 Region: 268-417
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 0.0000000000114
Family Oxidoreductase molybdopterin-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 114-210
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000011
Family Di-heme elbow motif 0.037
Further Details:      
 
Domain Number 3 Region: 444-529
Classification Level Classification E-value
Superfamily E set domains 0.000000000252
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257790166|ref|YP_003180772.1|
Sequence length 560
Comment molybdopterin binding oxidoreductase [Eggerthella lenta DSM 2243]
Sequence
MRNMRLKAALGMAGVLAMTAACCVVGPALAADSASTADEIVRGGEPDGDVQYPGKEYIVE
NYDKWDKIAEEYAPEIIRYSNGQLVQRTPTEYECPHWMQQSWTISYNTYYLDADNRGCNS
CHADMNAMIENMEYKHATIDNKALETYSDVNQCISCHRDNGDDFGRLIHAIHYNERSGNK
FAEGSNGTCQSCHDATADGNGMQLWDNVKHEALQGINKVENVQGEFASTQDKVQTQDELY
SYDFVHGYYDHMRYACGPNGLDIDLPQSMFDEWEFTVDGNVNAPYTKKLPELVAEAEAAG
VVVTKPSKMVCELNPIGGGGIGQAEITGIPVSWLIEKAGGYTEDTNSVRVIRADGSSRSG
FDLSVLDKGYLVYKIDGEYLSARHGFPVMHWQETYDAQIFSKQINGYHVSSDVMDERVCG
QVNQEDAHVNRPNVTVCGVPEGLIIQNGKPFTFNGYADAFDHPMKTVEFSMDGGETWTSF
DVGDVDPAKWLWWSFTFTPEKEGAYVLSVRGTDIDGEVSYRNHEVLVNAKDEMPSEDEIT
EIGKIVDPAMANGDASGDQQ
Download sequence
Identical sequences A0A096KUT6 C8WKS7
WP_015759959.1.14381 WP_015759959.1.87427 479437.Elen_0393 gi|257790166|ref|YP_003180772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]