SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790295|ref|YP_003180901.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790295|ref|YP_003180901.1|
Domain Number 1 Region: 72-223
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.52e-16
Family Di-heme elbow motif 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257790295|ref|YP_003180901.1|
Sequence length 231
Comment hypothetical protein Elen_0527 [Eggerthella lenta DSM 2243]
Sequence
MTVQAHAADRRLVVLAVLGVVLALTAAMWTLAGCAPKAETDAPAESGQKAEGSGSGSGSA
ASAMDGQPVNWTMESDCSMCHTSEAESATDAACPQATAHEAEGVACAQCHTDEGELSTAH
ADVKFGDKPASKPTMVTVDPATCESCHGTLEDMAAKTADSTALTDDKGTTVNPHERPAGE
KHEENPATCTDCHNNHSKDLPKDSMRYCAQCHHRGTFECGTCHELRERATT
Download sequence
Identical sequences A0A096KNC0 C8WLI2
WP_015760028.1.14381 WP_015760028.1.87427 gi|257790295|ref|YP_003180901.1| 479437.Elen_0527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]