SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790301|ref|YP_003180907.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790301|ref|YP_003180907.1|
Domain Number 1 Region: 62-218
Classification Level Classification E-value
Superfamily Multiheme cytochromes 5.43e-16
Family Di-heme elbow motif 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257790301|ref|YP_003180907.1|
Sequence length 222
Comment hypothetical protein Elen_0533 [Eggerthella lenta DSM 2243]
Sequence
MTVQAHIDDRRLVVLAVLGVVLALTAAMWTLAGCAPKAEPSAPAASEQKDGNGGSSAMDG
QPVNWTMDSDCSMCHTVEAASATDASCPQASAHEAEGVTCVQCHTDEAVLSTEHADVKFG
DKAATKATVVTVDPETCISCHGTMEEMAAKTADSTALTDDKGTTVNPHDDPSNEKHDANP
ATCTSCHNNHSKDQAKDAMKYCAQCHHRGTFECGTCHELRER
Download sequence
Identical sequences C8WLI8
479437.Elen_0533 gi|257790301|ref|YP_003180907.1| WP_015760034.1.14381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]