SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790348|ref|YP_003180954.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790348|ref|YP_003180954.1|
Domain Number 1 Region: 47-194
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000347
Family Di-heme elbow motif 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257790348|ref|YP_003180954.1|
Sequence length 195
Comment hypothetical protein Elen_0580 [Eggerthella lenta DSM 2243]
Sequence
MKKFTGAATISCAVIALALTACAPQSNENGAASADDAKETPITVAWSADSECGTCHATEQ
ASYDDAACVASTHEGQACISCHADASGLATAHEGKTASDTMPKKLKKTEVPDDACLSCHY
GAREELVAATVDVAVVDSKGTAVNPHDVTPSEQHDTIRCADCHGMHDAEKLADKADAECA
SCHHADVFECYTCHD
Download sequence
Identical sequences A0A096KS59 C8WM11 F0HKE5
gi|257790348|ref|YP_003180954.1| 479437.Elen_0580 WP_009306190.1.14381 WP_009306190.1.74853 WP_009306190.1.87427 WP_009306190.1.89587 WP_009306190.1.95410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]