SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790421|ref|YP_003181027.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790421|ref|YP_003181027.1|
Domain Number 1 Region: 263-435
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 6.02e-16
Family Oxidoreductase molybdopterin-binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 440-525
Classification Level Classification E-value
Superfamily E set domains 0.0000000000126
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.041
Further Details:      
 
Domain Number 3 Region: 94-187
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000073
Family Di-heme elbow motif 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257790421|ref|YP_003181027.1|
Sequence length 539
Comment hypothetical protein Elen_0655 [Eggerthella lenta DSM 2243]
Sequence
MRKKLMVVTAMLMAGSLFAAGCAQQGAAEGESSSTEVQYQNSIEEAEAYLDGVNERQDEL
NKEYAPEIRTLEDGTKVQRTPTEYQCYHWNRPYEGGTSYNNYYLDADNRGCGACHEDLGD
ALANMEYSHPTVWNDALGSKITVDQCMLCHSADDGYEMGTVMHGVHYGERNGENFEERGG
KCISCHNMTENEQGAELWDVVKYDHLDGIVKVPDVQGEFVFDQDTVVAPEDMFTYDWIHS
RYDSLIHIMGKNVLDTELPKDFVDNFEITMDGLVNKPFTAKLADLISEAEAAGVTVTKLS
KIHCVDNMPGGGGISNVEITGIPLTWLIEKAGGASKDITGVLFDRQEFRTNGAQTHSNRG
VPEASFEDVYLVYEIGGKPLDPSQGSPCINWVEKCDAQSYVKQCVGYKLTDEEKPWEDWM
MNGFNSYGEGPYINKPNATVLKVPEGMIIETGKPFTFEGYADAYDEAVVKLEFSMDNGKT
WTPYDLGQTDPSKWVYWHYTWTPESDGSYVLMVRGTTDTGLVGTNIQKVMVTAKSNVEG
Download sequence
Identical sequences A0A096KKX5 C8WM84 F0HSU4 T4B808
479437.Elen_0655 WP_009609514.1.14381 WP_009609514.1.74853 WP_009609514.1.87427 gi|257790421|ref|YP_003181027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]