SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790485|ref|YP_003181091.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790485|ref|YP_003181091.1|
Domain Number 1 Region: 94-324
Classification Level Classification E-value
Superfamily Sortase 2.22e-37
Family Sortase 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257790485|ref|YP_003181091.1|
Sequence length 357
Comment sortase [Eggerthella lenta DSM 2243]
Sequence
MSEYRQHPGPAPSGRPAQQRVPRGAAPDVRAGAQPGAYRPATAQHAAYRSAQPAQRRSAG
GGGYPYRQQPTYQQPGSGRPRKKSGPWRVVFWIALVVFVVALAALGAIGFSYWQGQQTYN
DVAREGFTPPDDLSATSLADFTVDWDALKAINPDTVGWIYIPGTVVNYPIVQAADDEKYL
THDFKGSEGWIATFGAIFLAAENSSDFSDPNNIIYGHHLNDGSMFACVADFSDAAQFNDH
RTVYILTPEGNYELSTFALVHVAADDPLAQMRFADEDERVAYVQDKIDRSVVPASDIPAA
SDIKHTFALATCDNLPSDGRYVLYSYVKASTVGEGDGDVIDPDAVAAIDSAEQEIAS
Download sequence
Identical sequences A0A096KHL3 C8WMS1
WP_015760115.1.14381 WP_015760115.1.87427 WP_015760115.1.95410 gi|257790485|ref|YP_003181091.1| 479437.Elen_0723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]