SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790554|ref|YP_003181160.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790554|ref|YP_003181160.1|
Domain Number 1 Region: 34-226
Classification Level Classification E-value
Superfamily Sortase 4.32e-18
Family Sortase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257790554|ref|YP_003181160.1|
Sequence length 230
Comment peptidase C60 sortase A and B [Eggerthella lenta DSM 2243]
Sequence
MKKLKIVAEGLGLVLAAVAVAALCTWIAADDNDKAGIAQSLEGAVSEESEHEEPLGIDWD
SLSQEIVAWVEAPNTSISQPVAKADKQNPNAYLFLDALDQGGYGTPYIDADCTGGSLLVP
IYGHNMSDGGVFSDFAKYSDESFARGHSRIDLYTRDGRSYNLSVIAVDVVDARYETMCPS
FGDAEAVAKQVAKSDVVLRKYDGESKVFAFTTCSYQAANSRAIVYAVPNR
Download sequence
Identical sequences C8WNB1
479437.Elen_0797 WP_015760166.1.14381 gi|257790554|ref|YP_003181160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]