SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790760|ref|YP_003181366.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790760|ref|YP_003181366.1|
Domain Number 1 Region: 23-169
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000419
Family Di-heme elbow motif 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257790760|ref|YP_003181366.1|
Sequence length 172
Comment hypothetical protein Elen_1005 [Eggerthella lenta DSM 2243]
Sequence
MNDRKRTKRLIALGVAAAVVVAAGAGFWVWHEQPSFCNAICHTPMDPYVEDYYADDATLL
AASHRVADVSCLDCHVPTLSEQLAEGVTWVAGGYALPLEQRQFDNAFCMNGSCHDIGQDS
LARITAQREYNPHSNFHEELACGTCHKSHTASVMQCAQCHSDADVPAGWVVR
Download sequence
Identical sequences C8WP89
479437.Elen_1005 WP_015760335.1.14381 gi|257790760|ref|YP_003181366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]