SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790768|ref|YP_003181374.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790768|ref|YP_003181374.1|
Domain Number 1 Region: 285-465
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 0.00000000000000209
Family Oxidoreductase molybdopterin-binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 476-578
Classification Level Classification E-value
Superfamily E set domains 0.000000000294
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 
Domain Number 3 Region: 128-218
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000115
Family Di-heme elbow motif 0.07
Further Details:      
 
Weak hits

Sequence:  gi|257790768|ref|YP_003181374.1|
Domain Number - Region: 207-246
Classification Level Classification E-value
Superfamily Cytochrome c 0.0207
Family monodomain cytochrome c 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257790768|ref|YP_003181374.1|
Sequence length 599
Comment molybdopterin binding oxidoreductase [Eggerthella lenta DSM 2243]
Sequence
MHAQRKIALVAVCALLGTVGIAGCAPQTNEALATGDQQTPQAEGHEYTDEQQSIIDGEEG
TVYDGISLDAYPGKDYLDGMHDMWDANVDQWAPELRTLPSGQIVQRTPSELAERARQGKT
PYNIYRLNNDNRGCNSCHADLDATLQHLAQTMHPSPNSPALDAEMTVDQCLFCHTYSPGY
IPTQYEFGTLIHNIHYGLEADSQFEDEYKGNCYSCHDATNDGEGMALWDQTKFERLRGVT
KVENVEGDFSIDQEATMAQEDMFNMDAWNRLYDRMRSGAEYADTPMPQSLFDSWPITVDG
EVNSPYTALLPDLVKEAEAAGVTVTKVSKEVCNWNGTGAGSVSNVEITGIPVSWLIERAG
GYADNADINGVRVMRADGSSKRAMPLDKVDGGEAFLVYKINGEQLTAANGFPCTNWCEGV
DPEVNSKQMNEYKVVTDAPDFDDHVYEFEHHDGNPNGWIDADGNWTNKPNATVLGVPEGL
VIQNGQPYTFHGYVDAYDEKIASVEFSMDFGKTWTKHDLGDTDVNKLVWFDFTWTPQEES
AYCLQLRATTESGLVSPQIQTVMVNAKDAMPAADETVVIDTPSLVAPKTAAAEVAEGKE
Download sequence
Identical sequences C8WP97
WP_015760343.1.14381 479437.Elen_1013 gi|257790768|ref|YP_003181374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]