SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257790846|ref|YP_003181452.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257790846|ref|YP_003181452.1|
Domain Number 1 Region: 295-463
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 4.58e-16
Family Oxidoreductase molybdopterin-binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 471-574
Classification Level Classification E-value
Superfamily E set domains 0.000000000084
Family E-set domains of sugar-utilizing enzymes 0.05
Further Details:      
 
Domain Number 3 Region: 127-231
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000166
Family Cytochrome c3-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257790846|ref|YP_003181452.1|
Sequence length 599
Comment molybdopterin binding oxidoreductase [Eggerthella lenta DSM 2243]
Sequence
MRLNKKAIIVATCAACTLGLAAGCAPQQSENAGAAAPSGDGGAVPQEQKLTPEQQAVIDG
AEGTTNEDIDENYYPGKEYLDNLWDRWDQVATEYAPEVRTLPNGQMVQRTPTEYEVNPDA
WQIQAGSNSYNTYWLDADNRGCESCHADMNSLLKHLPYEHPVAWNDELDNKTTLQQCLFC
HSYAPGYIAKQYEFGTLMHAVHYGSRTKSDFVNQYQGDCMSCHNATENGAGLELWDLTKY
DRLWGINDVENVQGDFKIDQERTQGQSGVFSYDWMHAYYDNMRHGAGVNGLDLEMPQSLF
DEWTITVDGNVNAEYTATLPELIKEAEADGAVITKTSKMVCNWNPVGGGGVTNTEITGIP
VSWLVEKAGGYKDGTTGVKALRADGSSKRAFPVDKVDSDEALLVYKIGGEYLDATRGYPC
TNWVEGVDAQINSKQIDTYHVTDEDIDYTDKWAGNPNGWQNEDDVPMNKPNATILGVPDG
LLVQNGQPYEFTGYVDGYDEKIASVEFSLDRGETWTKYDIGDMDRNKMVWWSFTYKPELE
GAYCLTVRATTESGMTSFETQTVMFNAKDKMPNPEDTTVLESASLIPPKVAAASDEKSE
Download sequence
Identical sequences C8WPH5 T4B0C5
WP_009304776.1.14381 WP_009304776.1.89587 WP_009304776.1.95410 gi|257790846|ref|YP_003181452.1| 479437.Elen_1092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]