SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257791145|ref|YP_003181751.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791145|ref|YP_003181751.1|
Domain Number 1 Region: 74-178
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000000255
Family Di-heme elbow motif 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|257791145|ref|YP_003181751.1|
Domain Number - Region: 36-82
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000314
Family Di-heme elbow motif 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257791145|ref|YP_003181751.1|
Sequence length 186
Comment hypothetical protein Elen_1393 [Eggerthella lenta DSM 2243]
Sequence
MEESKPSGKRRGRRWPIVVGVIAAVVVAAGAGFWVWHEQPSFCNAVCHDPMDVYVDGYFN
DATLMANAHERADVTCLKCHEAKLSDQVAEGLSWVRGDFATDETGHLTTHGVTADKKMCA
SAGCHDWEDVKAATEDWGGEAGVNPHASHQGEAIDCSNCHGAHGSSYMYCNACHDYAVPD
GWESPR
Download sequence
Identical sequences A0A096LF19 C8WGX1 F0HR57
gi|257791145|ref|YP_003181751.1| WP_009609114.1.14381 WP_009609114.1.74853 WP_009609114.1.87427 479437.Elen_1393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]