SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257791404|ref|YP_003182010.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257791404|ref|YP_003182010.1|
Domain Number - Region: 14-53
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0191
Family Di-heme elbow motif 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257791404|ref|YP_003182010.1|
Sequence length 149
Comment hypothetical protein Elen_1653 [Eggerthella lenta DSM 2243]
Sequence
MHRCDFRLPVRVLAAAALPLMGAVTLAGCSGASQHQVIDRNVACSSCHSDEKPVYEGATV
PSETVESGSRVQVKTSGAAVAVVARPVFTAEDGSGFVPVIDSSVALDGGEAVVELEDGLW
ALCLDEGDKARAKLVRVDSASDATAVVEL
Download sequence
Identical sequences C8WHN0 F0HNV6
gi|257791404|ref|YP_003182010.1| 479437.Elen_1653 WP_009608653.1.14381 WP_009608653.1.74853 WP_009608653.1.89587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]