SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257791488|ref|YP_003182094.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791488|ref|YP_003182094.1|
Domain Number 1 Region: 51-109
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000524
Family Cytochrome c3-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257791488|ref|YP_003182094.1|
Sequence length 110
Comment hypothetical protein Elen_1740 [Eggerthella lenta DSM 2243]
Sequence
MKKHMITAALVAVMALGLGTVAGCSQEAPREDVNANVPAGAPPLMPTSHDGRFENLGAAG
CYGCHGANDQANPMLADATALPADHYAGGDAGSLEMDPTHEQCITCHAQA
Download sequence
Identical sequences A0A096LLI2 C8WHW4 F0HNL2 T4BYG4
gi|257791488|ref|YP_003182094.1| WP_009307158.1.14381 WP_009307158.1.74853 WP_009307158.1.87427 WP_009307158.1.89587 WP_009307158.1.95410 479437.Elen_1740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]