SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257791655|ref|YP_003182261.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257791655|ref|YP_003182261.1|
Domain Number - Region: 89-139
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000335
Family Cytochrome c3-like 0.057
Further Details:      
 
Domain Number - Region: 20-79
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00706
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257791655|ref|YP_003182261.1|
Sequence length 183
Comment hypothetical protein Elen_1908 [Eggerthella lenta DSM 2243]
Sequence
MSELLNQLWTPELQAAFTVVVVLLVILYVLSIVWVVRDAYLRGSYWYVWAIVALVPLLGI
IAYCLLRPPLLQIDRDEQELEIALKQRELMKYGECANCGYPVEADFVLCPNCHQRLKNLC
GTCNHALDPTWTVCPYCATPVAGGPRTRRAPQQRGARTQQPQQAATQQQTRQARPAQSEH
GVQ
Download sequence
Identical sequences A0A096KR95 C8WID2 T4BWG5
479437.Elen_1908 WP_009304230.1.14381 WP_009304230.1.74853 WP_009304230.1.87427 WP_009304230.1.89587 WP_009304230.1.95410 gi|257791655|ref|YP_003182261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]