SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257792038|ref|YP_003182644.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792038|ref|YP_003182644.1|
Domain Number 1 Region: 10-89
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000398
Family Di-heme elbow motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257792038|ref|YP_003182644.1|
Sequence length 156
Comment C_GCAxxG_C_C family protein [Eggerthella lenta DSM 2243]
Sequence
MTIEDPRTRNPFDREALARRALELHGMKYNCAQAVACTLAPLIGADEELCFRAAEGLGGG
MGGLTETCGAVSGAAMAIGLANSNGQDDRTSKQATYRIVRKLVNDFREQNGSTLCPELKG
IKTKQPLRSCDGCIVDALQLAADALAGLPADKPLDA
Download sequence
Identical sequences A0A096LJ43 C8WK98 T4C5J8
WP_015761070.1.14381 WP_015761070.1.87427 WP_015761070.1.89587 gi|257792038|ref|YP_003182644.1| 479437.Elen_2296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]