SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257792322|ref|YP_003182928.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792322|ref|YP_003182928.1|
Domain Number 1 Region: 63-444
Classification Level Classification E-value
Superfamily Multiheme cytochromes 2.61e-92
Family Di-heme elbow motif 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257792322|ref|YP_003182928.1|
Sequence length 445
Comment Nitrite reductase [Eggerthella lenta DSM 2243]
Sequence
MVKTKRNKLAVWTASVCAFGMVMGLVACAPQATEDATEQKADENKTVQQVETPEPDKYGV
VTAESWKDAYPDQYASYMENKSNAPLQDGGDKHNYLELYPALNTMYKGYAFALGYDEAAS
HLYTLQSVKETPRTTQKEQLAGCITCKTPQFTAMVNDEGEGVYKEKFNDLIGEFTEPVSC
YNCHENDPQSLKVTGSYFVKALGNDAGEGSKAPMNSQVCGQCHNEYYFDGETKATTNPYT
GLDQMTPDAILAYYDERNFKDWNHADTFAPMIKVQHPEFETMHGGEQSPMAKAGYGCSDC
HMAPAEGANGEYTSHNWVSPLENKQLIENDCSKCHDDLEKKVKDIQASEEERVTAISEKI
EDMTNKIAAKYADEIAAMKAANEAKTDIPAASEELAKLQKLQRNAQFYWDFVMVENSEGA
HNSKLTNETLDKAEAAADEALAMLA
Download sequence
Identical sequences A0A096KLA8 C8WLS6 F0HS72
gi|257792322|ref|YP_003182928.1| WP_009306706.1.14381 WP_009306706.1.74853 WP_009306706.1.87427 WP_009306706.1.95410 479437.Elen_2586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]