SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257792421|ref|YP_003183027.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792421|ref|YP_003183027.1|
Domain Number 1 Region: 58-206
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000995
Family Di-heme elbow motif 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257792421|ref|YP_003183027.1|
Sequence length 207
Comment hypothetical protein Elen_2689 [Eggerthella lenta DSM 2243]
Sequence
MNVSAKKGMRALAPAAILLALCASLAGCGGTPQQAGGEAGKAGDTAQAAASDAPFSWSAD
ADCGLCHATQSSSLTDSSCQVSANHANLQCVQCHTDENGLAAAHDGVTLADTKGAKKLSK
TSVEQDACVSCHADAGAPEAAASSTALTDDQGTTVNPHDLPQSASHDTLTCGSCHTMHDE
KPLEETAAAACTQCHHQNVYECYTCHE
Download sequence
Identical sequences A0A096LKX1 C8WME3
479437.Elen_2689 gi|257792421|ref|YP_003183027.1| WP_015761353.1.14381 WP_015761353.1.87427 WP_015761353.1.89587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]