SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257792620|ref|YP_003183226.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792620|ref|YP_003183226.1|
Domain Number 1 Region: 51-114
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000000743
Family Di-heme elbow motif 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257792620|ref|YP_003183226.1|
Sequence length 122
Comment hypothetical protein Elen_2892 [Eggerthella lenta DSM 2243]
Sequence
MSRSTLRLDIMIALVAVALVAVFAIAGCAPQQADSGSSEGTKTQTVSSEAGAYVSDEQCL
SCHGGSYEALAERTADLGDWNPHDSLHGGYNACVNCHEKDKEITFNYCENCHVYAPDEEV
LY
Download sequence
Identical sequences A0A096LM24 C8WNP2 F0HQX6 T4BPM8
479437.Elen_2892 WP_009609084.1.14381 WP_009609084.1.74853 WP_009609084.1.87427 WP_009609084.1.89587 WP_009609084.1.95410 gi|257792620|ref|YP_003183226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]