SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257792731|ref|YP_003183337.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257792731|ref|YP_003183337.1|
Domain Number - Region: 38-67
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0879
Family Di-heme elbow motif 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257792731|ref|YP_003183337.1|
Sequence length 76
Comment hypothetical protein Elen_3005 [Eggerthella lenta DSM 2243]
Sequence
MIDDEKLAACFSDKGMELDDDDLDQASGGISCPDQIVFFCTRCHEAKTVTKTSSALICPD
CGTPFGASTSPNPDPT
Download sequence
Identical sequences A0A096KTH3 C8WPK4 F0HMR7
WP_009305362.1.14381 WP_009305362.1.74853 WP_009305362.1.87427 WP_009305362.1.95410 gi|257792731|ref|YP_003183337.1| 479437.Elen_3005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]