SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222097749|ref|YP_002531806.1| from Bacillus cereus Q1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222097749|ref|YP_002531806.1|
Domain Number 1 Region: 500-650
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000848
Family HD domain 0.035
Further Details:      
 
Weak hits

Sequence:  gi|222097749|ref|YP_002531806.1|
Domain Number - Region: 601-624
Classification Level Classification E-value
Superfamily HMG-box 0.082
Family HMG-box 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222097749|ref|YP_002531806.1|
Sequence length 714
Comment metal-dependent phosphohydrolase [Bacillus cereus Q1]
Sequence
MLRSQEISKWFRNLQHSKKLSWISYVLLGAVLFFALMNNVKPEQLDVDMYSIAKKTIHSP
IKIEDKVITERKKQEAAQKVGDQYTYRSEYKQNRVDIVNDVFAKVNEVIQEMKAAGPEEQ
KKMTDANKLEKLKKKLPSNLTKELSDENLLYFINAEPDQLELAKNAALTSVSVIMGGNIK
MSEEMAAKERFVNEMKSLNVNSGLKEAVNALGSYAITANYFYDPAVTKEKKKAEEDLVPP
VYILQGQVIVREGETISSDMYNQLKLVGLLEKGNSFQPYVGLAVLIGVLLYFMHKQFEVF
LQRKREDKPYILAYITILSITIVLMKIISLFQKLEYAGIAYVVPVAMGTILVKLMIGDRF
VFLTSMIFSVCGSIMFNEGVTSTLNYSVGIYVLLSSLSVSIFLREKNRRTMILQAGILVS
ILNVVVLAALLLLRNGNFSPLEIGTQLLMASLSGIISSVLAMGILPYLESGLGIVSSMKL
MELSSPNHPLLRRILLEAPGTYHHSVMVANLSEAACEAVGANGVLARVGAYYHDVGKTVQ
PQFFIENQMGIENPHDKLDPVTSKDIIIAHVTDGVKMLEEYHIPQEIIDIAGQHHGTTLL
KYFYYKAIKEDKEKYTEEMFRYPGSKATSKESAIVGIADSVEAAVRSMNHPTPDQINNLV
QSIIKDRLQDGQFSECDLTFKELQIVGKTLCETLNGIFHSRITYPEPPEDKEKE
Download sequence
Identical sequences A0A0T8XH51 A0A1J9YIJ1 A0A1T2P7T9 A0A229MWP2 A0A242YUQ1 A0A243I458 A0A243NNX1 A0A2C3GM57 A0A2J9BSH1 B7HPK3 B9IY71 F0PX68 J8JMT5
gi|222097749|ref|YP_002531806.1| gi|384182124|ref|YP_005567886.1| WP_000946450.1.100241 WP_000946450.1.100684 WP_000946450.1.10069 WP_000946450.1.100873 WP_000946450.1.101309 WP_000946450.1.10762 WP_000946450.1.12751 WP_000946450.1.13024 WP_000946450.1.13299 WP_000946450.1.17408 WP_000946450.1.17927 WP_000946450.1.18840 WP_000946450.1.20687 WP_000946450.1.21172 WP_000946450.1.21643 WP_000946450.1.23100 WP_000946450.1.24184 WP_000946450.1.24377 WP_000946450.1.24709 WP_000946450.1.26499 WP_000946450.1.27334 WP_000946450.1.29209 WP_000946450.1.31685 WP_000946450.1.32522 WP_000946450.1.33045 WP_000946450.1.33061 WP_000946450.1.3318 WP_000946450.1.3615 WP_000946450.1.37093 WP_000946450.1.37990 WP_000946450.1.38425 WP_000946450.1.38517 WP_000946450.1.41976 WP_000946450.1.43533 WP_000946450.1.43762 WP_000946450.1.44463 WP_000946450.1.46746 WP_000946450.1.46864 WP_000946450.1.47097 WP_000946450.1.47441 WP_000946450.1.48010 WP_000946450.1.48164 WP_000946450.1.48311 WP_000946450.1.48599 WP_000946450.1.49428 WP_000946450.1.50316 WP_000946450.1.50514 WP_000946450.1.51087 WP_000946450.1.52756 WP_000946450.1.54775 WP_000946450.1.54782 WP_000946450.1.55057 WP_000946450.1.56055 WP_000946450.1.57203 WP_000946450.1.57245 WP_000946450.1.57815 WP_000946450.1.57859 WP_000946450.1.58037 WP_000946450.1.58814 WP_000946450.1.59773 WP_000946450.1.60274 WP_000946450.1.61231 WP_000946450.1.64377 WP_000946450.1.6753 WP_000946450.1.70645 WP_000946450.1.72514 WP_000946450.1.77576 WP_000946450.1.77690 WP_000946450.1.79658 WP_000946450.1.79687 WP_000946450.1.80964 WP_000946450.1.81088 WP_000946450.1.82421 WP_000946450.1.82533 WP_000946450.1.82986 WP_000946450.1.83070 WP_000946450.1.84337 WP_000946450.1.8450 WP_000946450.1.87627 WP_000946450.1.8923 WP_000946450.1.89675 WP_000946450.1.91404 WP_000946450.1.91569 WP_000946450.1.91615 WP_000946450.1.93932 WP_000946450.1.95457 WP_000946450.1.95484 WP_000946450.1.95786 WP_000946450.1.99266 gi|217961794|ref|YP_002340364.1| gi|375286309|ref|YP_005106748.1| 361100.BCQ_4090 405534.BCAH187_A4437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]