SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222097954|ref|YP_002532011.1| from Bacillus cereus Q1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222097954|ref|YP_002532011.1|
Domain Number 1 Region: 45-113
Classification Level Classification E-value
Superfamily HMG-box 0.0000548
Family HMG-box 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222097954|ref|YP_002532011.1|
Sequence length 133
Comment hypothetical protein BCQ_4296 [Bacillus cereus Q1]
Sequence
MKVDSRIVVRFSVEEKEDLMEISSDLNLTLSSYIREKLLGGNLENNYLVFINNRLNQYNE
GQVFTLKELLGKHWNYMSKHERLHLLNVIIEEIEEEEMEMDIYKVTKKGKYKFIKSKDSY
YINELIEKYMEAD
Download sequence
Identical sequences B9IZ83
gi|222097954|ref|YP_002532011.1| 361100.BCQ_4296 WP_000861794.1.10762 WP_000861794.1.13024 WP_000861794.1.20687 WP_000861794.1.24184 WP_000861794.1.29209 WP_000861794.1.33045 WP_000861794.1.3318 WP_000861794.1.3615 WP_000861794.1.37093 WP_000861794.1.37990 WP_000861794.1.44463 WP_000861794.1.49428 WP_000861794.1.50316 WP_000861794.1.50514 WP_000861794.1.54775 WP_000861794.1.54782 WP_000861794.1.56055 WP_000861794.1.57203 WP_000861794.1.57815 WP_000861794.1.57859 WP_000861794.1.58814 WP_000861794.1.60274 WP_000861794.1.64377 WP_000861794.1.70645 WP_000861794.1.77690 WP_000861794.1.81088 WP_000861794.1.82533 WP_000861794.1.84337 WP_000861794.1.93932 WP_000861794.1.95457 WP_000861794.1.95484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]