SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225856781|ref|YP_002738292.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|225856781|ref|YP_002738292.1|
Domain Number - Region: 1-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000194
Family ArsC-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225856781|ref|YP_002738292.1|
Sequence length 126
Comment hypothetical protein SPP_1147 [Streptococcus pneumoniae P1031]
Sequence
MIDLYLSKNNHRNQLLLEFFQNYGIEVSCHSISEMTRDKLIEMMSYSSDCFEFLSPNLLR
FKNRDNLRLTDFIEMILKNPELTIRLPLAVSNKRVYPNLNLEEARALLPRDTKQLIYMAQ
THYLSN
Download sequence
Identical sequences A0A0T7KGY3
WP_000566528.1.100325 WP_000566528.1.11861 WP_000566528.1.12198 WP_000566528.1.1221 WP_000566528.1.12570 WP_000566528.1.12595 WP_000566528.1.12729 WP_000566528.1.12958 WP_000566528.1.13330 WP_000566528.1.13537 WP_000566528.1.1368 WP_000566528.1.14012 WP_000566528.1.14404 WP_000566528.1.14900 WP_000566528.1.15026 WP_000566528.1.1515 WP_000566528.1.15967 WP_000566528.1.16101 WP_000566528.1.1714 WP_000566528.1.17630 WP_000566528.1.1783 WP_000566528.1.18193 WP_000566528.1.18285 WP_000566528.1.20634 WP_000566528.1.21370 WP_000566528.1.21807 WP_000566528.1.21998 WP_000566528.1.22723 WP_000566528.1.22941 WP_000566528.1.23978 WP_000566528.1.24466 WP_000566528.1.26544 WP_000566528.1.26818 WP_000566528.1.27007 WP_000566528.1.27324 WP_000566528.1.28574 WP_000566528.1.28709 WP_000566528.1.29039 WP_000566528.1.29204 WP_000566528.1.29572 WP_000566528.1.29655 WP_000566528.1.29730 WP_000566528.1.30923 WP_000566528.1.3178 WP_000566528.1.31979 WP_000566528.1.34772 WP_000566528.1.34973 WP_000566528.1.35406 WP_000566528.1.37858 WP_000566528.1.38519 WP_000566528.1.38695 WP_000566528.1.38765 WP_000566528.1.38825 WP_000566528.1.38851 WP_000566528.1.39443 WP_000566528.1.395 WP_000566528.1.39596 WP_000566528.1.39710 WP_000566528.1.39866 WP_000566528.1.40117 WP_000566528.1.40400 WP_000566528.1.40682 WP_000566528.1.41757 WP_000566528.1.42030 WP_000566528.1.43289 WP_000566528.1.43900 WP_000566528.1.44127 WP_000566528.1.44498 WP_000566528.1.45006 WP_000566528.1.46874 WP_000566528.1.46878 WP_000566528.1.46934 WP_000566528.1.47043 WP_000566528.1.47133 WP_000566528.1.4933 WP_000566528.1.49656 WP_000566528.1.50489 WP_000566528.1.50530 WP_000566528.1.50621 WP_000566528.1.52108 WP_000566528.1.52157 WP_000566528.1.53340 WP_000566528.1.53820 WP_000566528.1.54473 WP_000566528.1.54631 WP_000566528.1.54971 WP_000566528.1.56995 WP_000566528.1.5710 WP_000566528.1.58197 WP_000566528.1.58483 WP_000566528.1.58697 WP_000566528.1.58811 WP_000566528.1.58854 WP_000566528.1.58877 WP_000566528.1.59589 WP_000566528.1.59883 WP_000566528.1.60961 WP_000566528.1.60993 WP_000566528.1.61214 WP_000566528.1.61278 WP_000566528.1.61348 WP_000566528.1.61992 WP_000566528.1.62814 WP_000566528.1.6288 WP_000566528.1.64756 WP_000566528.1.64782 WP_000566528.1.65319 WP_000566528.1.65352 WP_000566528.1.65887 WP_000566528.1.65960 WP_000566528.1.66688 WP_000566528.1.67761 WP_000566528.1.67930 WP_000566528.1.68853 WP_000566528.1.69057 WP_000566528.1.69137 WP_000566528.1.69285 WP_000566528.1.70436 WP_000566528.1.7262 WP_000566528.1.73812 WP_000566528.1.73851 WP_000566528.1.76591 WP_000566528.1.76874 WP_000566528.1.77663 WP_000566528.1.78191 WP_000566528.1.78275 WP_000566528.1.78455 WP_000566528.1.79298 WP_000566528.1.80449 WP_000566528.1.81190 WP_000566528.1.815 WP_000566528.1.81628 WP_000566528.1.81807 WP_000566528.1.82049 WP_000566528.1.82051 WP_000566528.1.82793 WP_000566528.1.82994 WP_000566528.1.83432 WP_000566528.1.8352 WP_000566528.1.83702 WP_000566528.1.83796 WP_000566528.1.83899 WP_000566528.1.84214 WP_000566528.1.85062 WP_000566528.1.85064 WP_000566528.1.85111 WP_000566528.1.86320 WP_000566528.1.86772 WP_000566528.1.89370 WP_000566528.1.89652 WP_000566528.1.89708 WP_000566528.1.89763 WP_000566528.1.90062 WP_000566528.1.90396 WP_000566528.1.91015 WP_000566528.1.91078 WP_000566528.1.93442 WP_000566528.1.9348 WP_000566528.1.93595 WP_000566528.1.94092 WP_000566528.1.94263 WP_000566528.1.94515 WP_000566528.1.94954 WP_000566528.1.96117 WP_000566528.1.9632 WP_000566528.1.96772 WP_000566528.1.97354 WP_000566528.1.9806 WP_000566528.1.98467 WP_000566528.1.98943 WP_000566528.1.99309 WP_000566528.1.99314 gi|225856781|ref|YP_002738292.1| 488223.SPP_1147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]