SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225857040|ref|YP_002738551.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225857040|ref|YP_002738551.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-40
Family ArsC-like 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225857040|ref|YP_002738551.1|
Sequence length 133
Comment transcriptional regulator Spx [Streptococcus pneumoniae P1031]
Sequence
MITLFLSPSCTSCRKAKAWLEKHKVPFVEHNIMTSPLTRKELQQILSLTENGTDDIISTR
SKIFQKLNIDVESISVSELLHLIEQYPSLLRRPIIIDAKRMQIGFNEDEIRAFLPRSYRK
QELKEARMRAGIS
Download sequence
Identical sequences A0A0B7M6G0 M5N4Q4
488223.SPP_1424 WP_000631260.1.100547 WP_000631260.1.101106 WP_000631260.1.10169 WP_000631260.1.101806 WP_000631260.1.12905 WP_000631260.1.1368 WP_000631260.1.13705 WP_000631260.1.14218 WP_000631260.1.14350 WP_000631260.1.15650 WP_000631260.1.15720 WP_000631260.1.16676 WP_000631260.1.17677 WP_000631260.1.17776 WP_000631260.1.1783 WP_000631260.1.18266 WP_000631260.1.21370 WP_000631260.1.21885 WP_000631260.1.21998 WP_000631260.1.2255 WP_000631260.1.22723 WP_000631260.1.23742 WP_000631260.1.24627 WP_000631260.1.25383 WP_000631260.1.27324 WP_000631260.1.27418 WP_000631260.1.27610 WP_000631260.1.27829 WP_000631260.1.28248 WP_000631260.1.2922 WP_000631260.1.29269 WP_000631260.1.29951 WP_000631260.1.31276 WP_000631260.1.3191 WP_000631260.1.31979 WP_000631260.1.33013 WP_000631260.1.33354 WP_000631260.1.33415 WP_000631260.1.33719 WP_000631260.1.34297 WP_000631260.1.3486 WP_000631260.1.35875 WP_000631260.1.3609 WP_000631260.1.36242 WP_000631260.1.37166 WP_000631260.1.39006 WP_000631260.1.395 WP_000631260.1.39585 WP_000631260.1.39710 WP_000631260.1.39985 WP_000631260.1.40041 WP_000631260.1.40602 WP_000631260.1.40682 WP_000631260.1.42546 WP_000631260.1.43644 WP_000631260.1.43900 WP_000631260.1.45006 WP_000631260.1.47043 WP_000631260.1.47394 WP_000631260.1.48213 WP_000631260.1.49025 WP_000631260.1.49178 WP_000631260.1.50234 WP_000631260.1.50532 WP_000631260.1.50621 WP_000631260.1.51635 WP_000631260.1.51855 WP_000631260.1.5256 WP_000631260.1.52957 WP_000631260.1.54529 WP_000631260.1.54576 WP_000631260.1.55523 WP_000631260.1.56023 WP_000631260.1.56257 WP_000631260.1.56505 WP_000631260.1.57867 WP_000631260.1.57977 WP_000631260.1.58034 WP_000631260.1.58402 WP_000631260.1.58854 WP_000631260.1.59198 WP_000631260.1.59766 WP_000631260.1.59883 WP_000631260.1.60521 WP_000631260.1.60529 WP_000631260.1.60961 WP_000631260.1.61217 WP_000631260.1.6192 WP_000631260.1.62390 WP_000631260.1.62391 WP_000631260.1.62566 WP_000631260.1.62862 WP_000631260.1.63468 WP_000631260.1.63621 WP_000631260.1.6414 WP_000631260.1.65265 WP_000631260.1.65352 WP_000631260.1.65607 WP_000631260.1.67196 WP_000631260.1.67274 WP_000631260.1.67930 WP_000631260.1.69137 WP_000631260.1.69148 WP_000631260.1.69512 WP_000631260.1.69671 WP_000631260.1.72043 WP_000631260.1.73320 WP_000631260.1.73593 WP_000631260.1.76002 WP_000631260.1.77659 WP_000631260.1.78455 WP_000631260.1.78755 WP_000631260.1.79104 WP_000631260.1.79527 WP_000631260.1.80435 WP_000631260.1.80914 WP_000631260.1.81090 WP_000631260.1.81360 WP_000631260.1.815 WP_000631260.1.81801 WP_000631260.1.82051 WP_000631260.1.82666 WP_000631260.1.83587 WP_000631260.1.8360 WP_000631260.1.83606 WP_000631260.1.83796 WP_000631260.1.84513 WP_000631260.1.84667 WP_000631260.1.84785 WP_000631260.1.8506 WP_000631260.1.85062 WP_000631260.1.85748 WP_000631260.1.86320 WP_000631260.1.86998 WP_000631260.1.89094 WP_000631260.1.89652 WP_000631260.1.89763 WP_000631260.1.90778 WP_000631260.1.91650 WP_000631260.1.92092 WP_000631260.1.94279 WP_000631260.1.94515 WP_000631260.1.96227 WP_000631260.1.98277 WP_000631260.1.9915 WP_000631260.1.99181 WP_000631260.1.99687 gi|225857040|ref|YP_002738551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]