SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225857088|ref|YP_002738599.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225857088|ref|YP_002738599.1|
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.76e-27
Family ArsC-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225857088|ref|YP_002738599.1|
Sequence length 118
Comment arsenate reductase [Streptococcus pneumoniae P1031]
Sequence
MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNWLETSGFELKQFFNTS
GIKYRELGLKDKVGSLSNQEAAELLASDGMLLKRPILVENGTVKQIGYRKSYEELGLK
Download sequence
Identical sequences A0A062WLS0 A0A081Q2J5 A0A0H2UQY9 A0A0H2ZMR7 A5LQ82 A5M884 B1ICP3 B2IQS7 C1C857 C1CF44 D6ZRS1 G6LNK8 I0T630 J1DFW2 M5K6E7 M5KC79 M5MQJ9 Q8DP75
gi|15903359|ref|NP_358909.1| gi|225860769|ref|YP_002742278.1| gi|556560722|ref|YP_008730070.1| gi|221232187|ref|YP_002511340.1| gi|387626700|ref|YP_006062876.1| gi|480531506|ref|YP_007763710.1| gi|387759601|ref|YP_006066579.1| gi|307126968|ref|YP_003878999.1| gi|15901312|ref|NP_345916.1| gi|169832450|ref|YP_001694878.1| gi|480536949|ref|YP_007814858.1| gi|298502584|ref|YP_003724524.1| gi|480535126|ref|YP_007813036.1| APC80513 gi|405760618|ref|YP_006701214.1| gi|307068112|ref|YP_003877078.1| gi|225854903|ref|YP_002736415.1| gi|116515586|ref|YP_816757.1| gi|480532500|ref|YP_007764703.1| gi|387787958|ref|YP_006253026.1| 170187.SP_1462 171101.spr1316 373153.SPD_1291 487213.SPT_0813 487214.SPH_1578 488221.SP70585_1503 488222.SPJ_1361 488223.SPP_1482 512566.SPG_1388 516950.SPCG_1449 561276.SPN23F_14260 NP_358909.1.60829 WP_000889093.1.1 WP_000889093.1.10 WP_000889093.1.100001 WP_000889093.1.100011 WP_000889093.1.100026 WP_000889093.1.100033 WP_000889093.1.100039 WP_000889093.1.100054 WP_000889093.1.10009 WP_000889093.1.100109 WP_000889093.1.100110 WP_000889093.1.100114 WP_000889093.1.100153 WP_000889093.1.100158 WP_000889093.1.10016 WP_000889093.1.100164 WP_000889093.1.100168 WP_000889093.1.100169 WP_000889093.1.100192 WP_000889093.1.100197 WP_000889093.1.10020 WP_000889093.1.100201 WP_000889093.1.100203 WP_000889093.1.100240 WP_000889093.1.100263 WP_000889093.1.100289 WP_000889093.1.100325 WP_000889093.1.100333 WP_000889093.1.100339 WP_000889093.1.100341 WP_000889093.1.10035 WP_000889093.1.100353 WP_000889093.1.100364 WP_000889093.1.100397 WP_000889093.1.100477 WP_000889093.1.10049 WP_000889093.1.100525 WP_000889093.1.100529 WP_000889093.1.100532 WP_000889093.1.100540 WP_000889093.1.100569 WP_000889093.1.100572 WP_000889093.1.100579 WP_000889093.1.1006 WP_000889093.1.100627 WP_000889093.1.100629 WP_000889093.1.100634 WP_000889093.1.100640 WP_000889093.1.100679 WP_000889093.1.100681 WP_000889093.1.100715 WP_000889093.1.100734 WP_000889093.1.100745 WP_000889093.1.100756 WP_000889093.1.100805 WP_000889093.1.100816 WP_000889093.1.100818 WP_000889093.1.100829 WP_000889093.1.100839 WP_000889093.1.100848 WP_000889093.1.100855 WP_000889093.1.100863 WP_000889093.1.100885 WP_000889093.1.100892 WP_000889093.1.100897 WP_000889093.1.100911 WP_000889093.1.100914 WP_000889093.1.100940 WP_000889093.1.100947 WP_000889093.1.10103 WP_000889093.1.101045 WP_000889093.1.101061 WP_000889093.1.101062 WP_000889093.1.101066 WP_000889093.1.101080 WP_000889093.1.101092 WP_000889093.1.101116 WP_000889093.1.101127 WP_000889093.1.101167 WP_000889093.1.101176 WP_000889093.1.101178 WP_000889093.1.10118 WP_000889093.1.101181 WP_000889093.1.101205 WP_000889093.1.101215 WP_000889093.1.101219 WP_000889093.1.10122 WP_000889093.1.10123 WP_000889093.1.101241 WP_000889093.1.101250 WP_000889093.1.101256 WP_000889093.1.101260 WP_000889093.1.101274 WP_000889093.1.101286 WP_000889093.1.101287 WP_000889093.1.101315 WP_000889093.1.101394 WP_000889093.1.101407 WP_000889093.1.101438 WP_000889093.1.101457 WP_000889093.1.101464 WP_000889093.1.101482 WP_000889093.1.101483 WP_000889093.1.101484 WP_000889093.1.101489 WP_000889093.1.101494 WP_000889093.1.101497 WP_000889093.1.101500 WP_000889093.1.101517 WP_000889093.1.10153 WP_000889093.1.101560 WP_000889093.1.101577 WP_000889093.1.101595 WP_000889093.1.101614 WP_000889093.1.101649 WP_000889093.1.101685 WP_000889093.1.101689 WP_000889093.1.10169 WP_000889093.1.101729 WP_000889093.1.101738 WP_000889093.1.101746 WP_000889093.1.10175 WP_000889093.1.101750 WP_000889093.1.101763 WP_000889093.1.101765 WP_000889093.1.101784 WP_000889093.1.101789 WP_000889093.1.101790 WP_000889093.1.101801 WP_000889093.1.101803 WP_000889093.1.101806 WP_000889093.1.10183 WP_000889093.1.101847 WP_000889093.1.101875 WP_000889093.1.101876 WP_000889093.1.101895 WP_000889093.1.10192 WP_000889093.1.101946 WP_000889093.1.10196 WP_000889093.1.101974 WP_000889093.1.101988 WP_000889093.1.1020 WP_000889093.1.102004 WP_000889093.1.102006 WP_000889093.1.102077 WP_000889093.1.102086 WP_000889093.1.102091 WP_000889093.1.102114 WP_000889093.1.102115 WP_000889093.1.102129 WP_000889093.1.102134 WP_000889093.1.10221 WP_000889093.1.1026 WP_000889093.1.10261 WP_000889093.1.10284 WP_000889093.1.10295 WP_000889093.1.10314 WP_000889093.1.10337 WP_000889093.1.1034 WP_000889093.1.10364 WP_000889093.1.10367 WP_000889093.1.10434 WP_000889093.1.10437 WP_000889093.1.10449 WP_000889093.1.10458 WP_000889093.1.10494 WP_000889093.1.10499 WP_000889093.1.1050 WP_000889093.1.10515 WP_000889093.1.10540 WP_000889093.1.10546 WP_000889093.1.10571 WP_000889093.1.10585 WP_000889093.1.1059 WP_000889093.1.10591 WP_000889093.1.10613 WP_000889093.1.10619 WP_000889093.1.1068 WP_000889093.1.10683 WP_000889093.1.1069 WP_000889093.1.1070 WP_000889093.1.10708 WP_000889093.1.10713 WP_000889093.1.10731 WP_000889093.1.1076 WP_000889093.1.10760 WP_000889093.1.10766 WP_000889093.1.10789 WP_000889093.1.10807 WP_000889093.1.10812 WP_000889093.1.10820 WP_000889093.1.10827 WP_000889093.1.10828 WP_000889093.1.1083 WP_000889093.1.10900 WP_000889093.1.1091 WP_000889093.1.10910 WP_000889093.1.10914 WP_000889093.1.10933 WP_000889093.1.10934 WP_000889093.1.10937 WP_000889093.1.10948 WP_000889093.1.10951 WP_000889093.1.10952 WP_000889093.1.10987 WP_000889093.1.11 WP_000889093.1.11007 WP_000889093.1.11035 WP_000889093.1.11043 WP_000889093.1.11045 WP_000889093.1.11082 WP_000889093.1.11085 WP_000889093.1.11093 WP_000889093.1.11096 WP_000889093.1.11102 WP_000889093.1.11103 WP_000889093.1.11115 WP_000889093.1.11139 WP_000889093.1.11144 WP_000889093.1.11197 WP_000889093.1.11205 WP_000889093.1.11233 WP_000889093.1.11243 WP_000889093.1.11279 WP_000889093.1.11289 WP_000889093.1.11298 WP_000889093.1.11299 WP_000889093.1.1131 WP_000889093.1.11319 WP_000889093.1.11328 WP_000889093.1.11337 WP_000889093.1.11358 WP_000889093.1.11425 WP_000889093.1.11428 WP_000889093.1.11435 WP_000889093.1.11439 WP_000889093.1.11474 WP_000889093.1.11486 WP_000889093.1.11495 WP_000889093.1.11509 WP_000889093.1.11510 WP_000889093.1.11537 WP_000889093.1.11546 WP_000889093.1.11563 WP_000889093.1.11570 WP_000889093.1.11573 WP_000889093.1.11617 WP_000889093.1.11619 WP_000889093.1.11622 WP_000889093.1.11624 WP_000889093.1.1165 WP_000889093.1.11652 WP_000889093.1.11657 WP_000889093.1.11664 WP_000889093.1.11669 WP_000889093.1.11706 WP_000889093.1.11765 WP_000889093.1.1178 WP_000889093.1.11792 WP_000889093.1.11811 WP_000889093.1.11842 WP_000889093.1.11849 WP_000889093.1.11858 WP_000889093.1.11860 WP_000889093.1.11861 WP_000889093.1.11871 WP_000889093.1.11872 WP_000889093.1.11902 WP_000889093.1.1192 WP_000889093.1.11922 WP_000889093.1.11931 WP_000889093.1.11935 WP_000889093.1.11950 WP_000889093.1.11967 WP_000889093.1.12023 WP_000889093.1.12024 WP_000889093.1.12034 WP_000889093.1.12044 WP_000889093.1.12062 WP_000889093.1.12068 WP_000889093.1.12078 WP_000889093.1.12084 WP_000889093.1.12085 WP_000889093.1.12099 WP_000889093.1.12128 WP_000889093.1.12134 WP_000889093.1.12182 WP_000889093.1.12186 WP_000889093.1.12198 WP_000889093.1.12218 WP_000889093.1.12222 WP_000889093.1.12238 WP_000889093.1.12243 WP_000889093.1.12273 WP_000889093.1.12306 WP_000889093.1.12307 WP_000889093.1.12312 WP_000889093.1.1233 WP_000889093.1.12337 WP_000889093.1.12339 WP_000889093.1.12378 WP_000889093.1.12383 WP_000889093.1.12395 WP_000889093.1.124 WP_000889093.1.12404 WP_000889093.1.12405 WP_000889093.1.12407 WP_000889093.1.12413 WP_000889093.1.12428 WP_000889093.1.12429 WP_000889093.1.1243 WP_000889093.1.12430 WP_000889093.1.12435 WP_000889093.1.12440 WP_000889093.1.12443 WP_000889093.1.12444 WP_000889093.1.12450 WP_000889093.1.12470 WP_000889093.1.12487 WP_000889093.1.12489 WP_000889093.1.12492 WP_000889093.1.12494 WP_000889093.1.12506 WP_000889093.1.12524 WP_000889093.1.12538 WP_000889093.1.12543 WP_000889093.1.12570 WP_000889093.1.12573 WP_000889093.1.12578 WP_000889093.1.12580 WP_000889093.1.12583 WP_000889093.1.12587 WP_000889093.1.12588 WP_000889093.1.12595 WP_000889093.1.1262 WP_000889093.1.12651 WP_000889093.1.12673 WP_000889093.1.12677 WP_000889093.1.12681 WP_000889093.1.12723 WP_000889093.1.12754 WP_000889093.1.12757 WP_000889093.1.12777 WP_000889093.1.12786 WP_000889093.1.128 WP_000889093.1.12800 WP_000889093.1.12805 WP_000889093.1.12811 WP_000889093.1.1282 WP_000889093.1.12859 WP_000889093.1.1288 WP_000889093.1.12928 WP_000889093.1.12942 WP_000889093.1.12952 WP_000889093.1.12958 WP_000889093.1.12963 WP_000889093.1.12966 WP_000889093.1.12985 WP_000889093.1.12996 WP_000889093.1.13000 WP_000889093.1.1302 WP_000889093.1.13023 WP_000889093.1.1303 WP_000889093.1.13032 WP_000889093.1.13033 WP_000889093.1.13035 WP_000889093.1.13036 WP_000889093.1.13048 WP_000889093.1.13058 WP_000889093.1.13065 WP_000889093.1.13067 WP_000889093.1.13099 WP_000889093.1.13100 WP_000889093.1.13121 WP_000889093.1.13123 WP_000889093.1.13140 WP_000889093.1.13152 WP_000889093.1.13187 WP_000889093.1.13245 WP_000889093.1.13256 WP_000889093.1.13276 WP_000889093.1.1328 WP_000889093.1.13286 WP_000889093.1.1330 WP_000889093.1.13305 WP_000889093.1.1332 WP_000889093.1.13324 WP_000889093.1.13327 WP_000889093.1.13328 WP_000889093.1.13330 WP_000889093.1.13331 WP_000889093.1.13340 WP_000889093.1.13351 WP_000889093.1.13382 WP_000889093.1.13388 WP_000889093.1.13390 WP_000889093.1.13394 WP_000889093.1.13402 WP_000889093.1.13410 WP_000889093.1.13455 WP_000889093.1.13515 WP_000889093.1.13537 WP_000889093.1.13560 WP_000889093.1.13565 WP_000889093.1.13570 WP_000889093.1.13584 WP_000889093.1.13590 WP_000889093.1.13604 WP_000889093.1.13606 WP_000889093.1.13607 WP_000889093.1.13643 WP_000889093.1.1367 WP_000889093.1.1368 WP_000889093.1.13682 WP_000889093.1.13692 WP_000889093.1.13701 WP_000889093.1.13705 WP_000889093.1.13710 WP_000889093.1.13729 WP_000889093.1.13736 WP_000889093.1.13738 WP_000889093.1.13745 WP_000889093.1.13830 WP_000889093.1.13839 WP_000889093.1.13854 WP_000889093.1.13873 WP_000889093.1.13886 WP_000889093.1.13903 WP_000889093.1.13917 WP_000889093.1.13954 WP_000889093.1.13960 WP_000889093.1.13989 WP_000889093.1.1399 WP_000889093.1.13990 WP_000889093.1.13997 WP_000889093.1.13998 WP_000889093.1.13999 WP_000889093.1.14002 WP_000889093.1.14033 WP_000889093.1.14051 WP_000889093.1.14060 WP_000889093.1.14066 WP_000889093.1.14077 WP_000889093.1.14082 WP_000889093.1.14102 WP_000889093.1.14107 WP_000889093.1.14126 WP_000889093.1.14131 WP_000889093.1.14166 WP_000889093.1.14183 WP_000889093.1.14206 WP_000889093.1.14211 WP_000889093.1.14217 WP_000889093.1.14218 WP_000889093.1.14254 WP_000889093.1.14258 WP_000889093.1.14260 WP_000889093.1.14287 WP_000889093.1.14291 WP_000889093.1.14294 WP_000889093.1.14295 WP_000889093.1.14301 WP_000889093.1.1432 WP_000889093.1.14327 WP_000889093.1.14335 WP_000889093.1.14347 WP_000889093.1.14384 WP_000889093.1.14404 WP_000889093.1.14430 WP_000889093.1.14435 WP_000889093.1.14440 WP_000889093.1.14480 WP_000889093.1.14488 WP_000889093.1.1449 WP_000889093.1.145 WP_000889093.1.14513 WP_000889093.1.14534 WP_000889093.1.14558 WP_000889093.1.14560 WP_000889093.1.14578 WP_000889093.1.14599 WP_000889093.1.14622 WP_000889093.1.14657 WP_000889093.1.14662 WP_000889093.1.14663 WP_000889093.1.14682 WP_000889093.1.14722 WP_000889093.1.14740 WP_000889093.1.14745 WP_000889093.1.14757 WP_000889093.1.14779 WP_000889093.1.14780 WP_000889093.1.14784 WP_000889093.1.14826 WP_000889093.1.14831 WP_000889093.1.14880 WP_000889093.1.14885 WP_000889093.1.14889 WP_000889093.1.14892 WP_000889093.1.14900 WP_000889093.1.14949 WP_000889093.1.14957 WP_000889093.1.14959 WP_000889093.1.14975 WP_000889093.1.14983 WP_000889093.1.1502 WP_000889093.1.15024 WP_000889093.1.15026 WP_000889093.1.15048 WP_000889093.1.15058 WP_000889093.1.15061 WP_000889093.1.1507 WP_000889093.1.15081 WP_000889093.1.15086 WP_000889093.1.15104 WP_000889093.1.15106 WP_000889093.1.15113 WP_000889093.1.15128 WP_000889093.1.15135 WP_000889093.1.15139 WP_000889093.1.15142 WP_000889093.1.15149 WP_000889093.1.1515 WP_000889093.1.15155 WP_000889093.1.15157 WP_000889093.1.15162 WP_000889093.1.15189 WP_000889093.1.1522 WP_000889093.1.15220 WP_000889093.1.15254 WP_000889093.1.15266 WP_000889093.1.15305 WP_000889093.1.15344 WP_000889093.1.15366 WP_000889093.1.15370 WP_000889093.1.15390 WP_000889093.1.15391 WP_000889093.1.15398 WP_000889093.1.1541 WP_000889093.1.15427 WP_000889093.1.15440 WP_000889093.1.1549 WP_000889093.1.15504 WP_000889093.1.15506 WP_000889093.1.15513 WP_000889093.1.15523 WP_000889093.1.15542 WP_000889093.1.15552 WP_000889093.1.15575 WP_000889093.1.15578 WP_000889093.1.15588 WP_000889093.1.15607 WP_000889093.1.15635 WP_000889093.1.15648 WP_000889093.1.15650 WP_000889093.1.1566 WP_000889093.1.15661 WP_000889093.1.15671 WP_000889093.1.15690 WP_000889093.1.15701 WP_000889093.1.15759 WP_000889093.1.15761 WP_000889093.1.15787 WP_000889093.1.15788 WP_000889093.1.15797 WP_000889093.1.15798 WP_000889093.1.15800 WP_000889093.1.1584 WP_000889093.1.15841 WP_000889093.1.15844 WP_000889093.1.15849 WP_000889093.1.15854 WP_000889093.1.15872 WP_000889093.1.15891 WP_000889093.1.15907 WP_000889093.1.15917 WP_000889093.1.15918 WP_000889093.1.15935 WP_000889093.1.15955 WP_000889093.1.15965 WP_000889093.1.15967 WP_000889093.1.15968 WP_000889093.1.16049 WP_000889093.1.16053 WP_000889093.1.16056 WP_000889093.1.16064 WP_000889093.1.16093 WP_000889093.1.16101 WP_000889093.1.16145 WP_000889093.1.16152 WP_000889093.1.16181 WP_000889093.1.16184 WP_000889093.1.16218 WP_000889093.1.16220 WP_000889093.1.16240 WP_000889093.1.16259 WP_000889093.1.16282 WP_000889093.1.16287 WP_000889093.1.16290 WP_000889093.1.16302 WP_000889093.1.16306 WP_000889093.1.16316 WP_000889093.1.16317 WP_000889093.1.16323 WP_000889093.1.16330 WP_000889093.1.16336 WP_000889093.1.16337 WP_000889093.1.16357 WP_000889093.1.16359 WP_000889093.1.16375 WP_000889093.1.16381 WP_000889093.1.16385 WP_000889093.1.16404 WP_000889093.1.16437 WP_000889093.1.16441 WP_000889093.1.16457 WP_000889093.1.16470 WP_000889093.1.16479 WP_000889093.1.16509 WP_000889093.1.16514 WP_000889093.1.16527 WP_000889093.1.1653 WP_000889093.1.16543 WP_000889093.1.16550 WP_000889093.1.16555 WP_000889093.1.16568 WP_000889093.1.16570 WP_000889093.1.16575 WP_000889093.1.1672 WP_000889093.1.16730 WP_000889093.1.16741 WP_000889093.1.16793 WP_000889093.1.168 WP_000889093.1.16803 WP_000889093.1.16813 WP_000889093.1.16814 WP_000889093.1.1682 WP_000889093.1.16831 WP_000889093.1.1684 WP_000889093.1.16884 WP_000889093.1.16886 WP_000889093.1.16902 WP_000889093.1.16904 WP_000889093.1.16911 WP_000889093.1.16947 WP_000889093.1.16952 WP_000889093.1.16955 WP_000889093.1.16956 WP_000889093.1.1698 WP_000889093.1.17003 WP_000889093.1.17029 WP_000889093.1.17036 WP_000889093.1.17045 WP_000889093.1.17063 WP_000889093.1.17091 WP_000889093.1.1711 WP_000889093.1.1714 WP_000889093.1.17163 WP_000889093.1.17178 WP_000889093.1.17208 WP_000889093.1.17214 WP_000889093.1.17220 WP_000889093.1.17227 WP_000889093.1.17229 WP_000889093.1.17238 WP_000889093.1.1724 WP_000889093.1.17252 WP_000889093.1.17257 WP_000889093.1.17263 WP_000889093.1.17269 WP_000889093.1.17279 WP_000889093.1.17286 WP_000889093.1.17291 WP_000889093.1.17312 WP_000889093.1.17315 WP_000889093.1.17330 WP_000889093.1.17340 WP_000889093.1.17355 WP_000889093.1.17372 WP_000889093.1.17411 WP_000889093.1.1742 WP_000889093.1.17420 WP_000889093.1.17427 WP_000889093.1.17438 WP_000889093.1.17472 WP_000889093.1.17474 WP_000889093.1.17532 WP_000889093.1.17537 WP_000889093.1.17562 WP_000889093.1.17571 WP_000889093.1.17601 WP_000889093.1.17602 WP_000889093.1.17609 WP_000889093.1.17630 WP_000889093.1.17639 WP_000889093.1.17652 WP_000889093.1.17665 WP_000889093.1.17672 WP_000889093.1.17677 WP_000889093.1.17690 WP_000889093.1.17691 WP_000889093.1.17692 WP_000889093.1.17706 WP_000889093.1.17715 WP_000889093.1.17716 WP_000889093.1.17784 WP_000889093.1.17810 WP_000889093.1.17826 WP_000889093.1.1783 WP_000889093.1.17839 WP_000889093.1.17844 WP_000889093.1.17854 WP_000889093.1.17858 WP_000889093.1.17892 WP_000889093.1.17895 WP_000889093.1.17917 WP_000889093.1.17933 WP_000889093.1.17942 WP_000889093.1.17954 WP_000889093.1.17971 WP_000889093.1.17972 WP_000889093.1.180 WP_000889093.1.18012 WP_000889093.1.18018 WP_000889093.1.18040 WP_000889093.1.18067 WP_000889093.1.18081 WP_000889093.1.18127 WP_000889093.1.18130 WP_000889093.1.18131 WP_000889093.1.18147 WP_000889093.1.1815 WP_000889093.1.18166 WP_000889093.1.18180 WP_000889093.1.18193 WP_000889093.1.18215 WP_000889093.1.18230 WP_000889093.1.18233 WP_000889093.1.18244 WP_000889093.1.18255 WP_000889093.1.18258 WP_000889093.1.1826 WP_000889093.1.18276 WP_000889093.1.18279 WP_000889093.1.18300 WP_000889093.1.18361 WP_000889093.1.1839 WP_000889093.1.184 WP_000889093.1.18404 WP_000889093.1.18417 WP_000889093.1.18449 WP_000889093.1.18457 WP_000889093.1.1846 WP_000889093.1.18460 WP_000889093.1.18464 WP_000889093.1.1848 WP_000889093.1.18481 WP_000889093.1.18488 WP_000889093.1.18496 WP_000889093.1.18514 WP_000889093.1.18521 WP_000889093.1.18528 WP_000889093.1.18534 WP_000889093.1.18555 WP_000889093.1.1856 WP_000889093.1.18571 WP_000889093.1.18572 WP_000889093.1.18597 WP_000889093.1.18630 WP_000889093.1.18634 WP_000889093.1.18638 WP_000889093.1.18644 WP_000889093.1.18670 WP_000889093.1.18687 WP_000889093.1.18712 WP_000889093.1.1872 WP_000889093.1.18733 WP_000889093.1.18764 WP_000889093.1.18768 WP_000889093.1.18770 WP_000889093.1.18771 WP_000889093.1.18831 WP_000889093.1.18864 WP_000889093.1.18869 WP_000889093.1.1887 WP_000889093.1.18884 WP_000889093.1.18894 WP_000889093.1.18903 WP_000889093.1.18920 WP_000889093.1.1894 WP_000889093.1.18946 WP_000889093.1.18948 WP_000889093.1.18951 WP_000889093.1.18955 WP_000889093.1.18985 WP_000889093.1.19000 WP_000889093.1.19003 WP_000889093.1.19015 WP_000889093.1.1902 WP_000889093.1.19045 WP_000889093.1.19060 WP_000889093.1.19103 WP_000889093.1.19104 WP_000889093.1.19124 WP_000889093.1.19127 WP_000889093.1.19172 WP_000889093.1.19184 WP_000889093.1.19216 WP_000889093.1.19218 WP_000889093.1.19236 WP_000889093.1.19237 WP_000889093.1.19239 WP_000889093.1.19267 WP_000889093.1.19275 WP_000889093.1.19359 WP_000889093.1.19368 WP_000889093.1.19383 WP_000889093.1.19392 WP_000889093.1.19413 WP_000889093.1.19420 WP_000889093.1.19466 WP_000889093.1.19467 WP_000889093.1.19470 WP_000889093.1.19489 WP_000889093.1.19490 WP_000889093.1.19493 WP_000889093.1.19510 WP_000889093.1.19527 WP_000889093.1.19530 WP_000889093.1.19532 WP_000889093.1.19558 WP_000889093.1.19559 WP_000889093.1.1956 WP_000889093.1.19586 WP_000889093.1.19603 WP_000889093.1.19631 WP_000889093.1.19633 WP_000889093.1.19677 WP_000889093.1.19719 WP_000889093.1.19721 WP_000889093.1.19729 WP_000889093.1.19754 WP_000889093.1.19773 WP_000889093.1.19811 WP_000889093.1.19827 WP_000889093.1.1983 WP_000889093.1.19832 WP_000889093.1.19837 WP_000889093.1.1985 WP_000889093.1.19856 WP_000889093.1.19880 WP_000889093.1.19942 WP_000889093.1.1996 WP_000889093.1.19961 WP_000889093.1.19965 WP_000889093.1.19983 WP_000889093.1.19995 WP_000889093.1.19998 WP_000889093.1.20008 WP_000889093.1.20011 WP_000889093.1.20015 WP_000889093.1.20041 WP_000889093.1.20045 WP_000889093.1.20079 WP_000889093.1.20105 WP_000889093.1.20108 WP_000889093.1.20110 WP_000889093.1.20128 WP_000889093.1.2017 WP_000889093.1.20185 WP_000889093.1.2019 WP_000889093.1.20207 WP_000889093.1.20209 WP_000889093.1.20227 WP_000889093.1.20241 WP_000889093.1.20250 WP_000889093.1.20279 WP_000889093.1.20281 WP_000889093.1.20298 WP_000889093.1.203 WP_000889093.1.2030 WP_000889093.1.20312 WP_000889093.1.20328 WP_000889093.1.20363 WP_000889093.1.20374 WP_000889093.1.20382 WP_000889093.1.20385 WP_000889093.1.20396 WP_000889093.1.20407 WP_000889093.1.20408 WP_000889093.1.20413 WP_000889093.1.20421 WP_000889093.1.20422 WP_000889093.1.20451 WP_000889093.1.2048 WP_000889093.1.20491 WP_000889093.1.20505 WP_000889093.1.20516 WP_000889093.1.20568 WP_000889093.1.2060 WP_000889093.1.20603 WP_000889093.1.20657 WP_000889093.1.20671 WP_000889093.1.20681 WP_000889093.1.20693 WP_000889093.1.207 WP_000889093.1.20701 WP_000889093.1.20702 WP_000889093.1.20711 WP_000889093.1.20719 WP_000889093.1.20766 WP_000889093.1.2078 WP_000889093.1.20782 WP_000889093.1.20858 WP_000889093.1.20892 WP_000889093.1.20909 WP_000889093.1.20915 WP_000889093.1.20934 WP_000889093.1.20936 WP_000889093.1.20942 WP_000889093.1.20965 WP_000889093.1.20966 WP_000889093.1.20969 WP_000889093.1.20976 WP_000889093.1.20981 WP_000889093.1.20984 WP_000889093.1.20996 WP_000889093.1.21027 WP_000889093.1.21090 WP_000889093.1.21095 WP_000889093.1.21097 WP_000889093.1.21175 WP_000889093.1.21216 WP_000889093.1.21230 WP_000889093.1.21233 WP_000889093.1.21256 WP_000889093.1.21271 WP_000889093.1.21278 WP_000889093.1.21297 WP_000889093.1.213 WP_000889093.1.21331 WP_000889093.1.21370 WP_000889093.1.21377 WP_000889093.1.21381 WP_000889093.1.21394 WP_000889093.1.21422 WP_000889093.1.21426 WP_000889093.1.21433 WP_000889093.1.21436 WP_000889093.1.21445 WP_000889093.1.2147 WP_000889093.1.21472 WP_000889093.1.21490 WP_000889093.1.21495 WP_000889093.1.21496 WP_000889093.1.21503 WP_000889093.1.21507 WP_000889093.1.21518 WP_000889093.1.21551 WP_000889093.1.21599 WP_000889093.1.21604 WP_000889093.1.21605 WP_000889093.1.21610 WP_000889093.1.21612 WP_000889093.1.21620 WP_000889093.1.21630 WP_000889093.1.21642 WP_000889093.1.2167 WP_000889093.1.21675 WP_000889093.1.21682 WP_000889093.1.21684 WP_000889093.1.21685 WP_000889093.1.21691 WP_000889093.1.21697 WP_000889093.1.21699 WP_000889093.1.21701 WP_000889093.1.2173 WP_000889093.1.21735 WP_000889093.1.21753 WP_000889093.1.21780 WP_000889093.1.21781 WP_000889093.1.21788 WP_000889093.1.21790 WP_000889093.1.2180 WP_000889093.1.21806 WP_000889093.1.21816 WP_000889093.1.21821 WP_000889093.1.21822 WP_000889093.1.21824 WP_000889093.1.21838 WP_000889093.1.21848 WP_000889093.1.21904 WP_000889093.1.21949 WP_000889093.1.21957 WP_000889093.1.2197 WP_000889093.1.21979 WP_000889093.1.21990 WP_000889093.1.21997 WP_000889093.1.21998 WP_000889093.1.22014 WP_000889093.1.22016 WP_000889093.1.2202 WP_000889093.1.22035 WP_000889093.1.22043 WP_000889093.1.22048 WP_000889093.1.22058 WP_000889093.1.22061 WP_000889093.1.22083 WP_000889093.1.22121 WP_000889093.1.22122 WP_000889093.1.22131 WP_000889093.1.22135 WP_000889093.1.22146 WP_000889093.1.22186 WP_000889093.1.22196 WP_000889093.1.22201 WP_000889093.1.22262 WP_000889093.1.22263 WP_000889093.1.22271 WP_000889093.1.22297 WP_000889093.1.223 WP_000889093.1.22338 WP_000889093.1.22341 WP_000889093.1.22343 WP_000889093.1.22368 WP_000889093.1.22382 WP_000889093.1.22392 WP_000889093.1.22397 WP_000889093.1.22422 WP_000889093.1.22436 WP_000889093.1.22439 WP_000889093.1.22457 WP_000889093.1.22459 WP_000889093.1.22480 WP_000889093.1.22503 WP_000889093.1.22505 WP_000889093.1.22506 WP_000889093.1.22513 WP_000889093.1.22550 WP_000889093.1.22554 WP_000889093.1.22556 WP_000889093.1.22561 WP_000889093.1.22563 WP_000889093.1.2257 WP_000889093.1.22591 WP_000889093.1.22596 WP_000889093.1.22616 WP_000889093.1.2263 WP_000889093.1.22636 WP_000889093.1.22637 WP_000889093.1.22638 WP_000889093.1.22640 WP_000889093.1.22643 WP_000889093.1.22655 WP_000889093.1.22675 WP_000889093.1.22677 WP_000889093.1.22700 WP_000889093.1.22711 WP_000889093.1.22717 WP_000889093.1.22720 WP_000889093.1.22723 WP_000889093.1.22751 WP_000889093.1.22753 WP_000889093.1.22761 WP_000889093.1.22763 WP_000889093.1.22784 WP_000889093.1.22791 WP_000889093.1.22820 WP_000889093.1.22839 WP_000889093.1.22884 WP_000889093.1.22897 WP_000889093.1.22904 WP_000889093.1.22914 WP_000889093.1.22938 WP_000889093.1.2295 WP_000889093.1.22955 WP_000889093.1.2296 WP_000889093.1.2297 WP_000889093.1.22976 WP_000889093.1.23016 WP_000889093.1.23018 WP_000889093.1.23025 WP_000889093.1.23028 WP_000889093.1.23039 WP_000889093.1.23043 WP_000889093.1.23066 WP_000889093.1.23076 WP_000889093.1.23077 WP_000889093.1.23083 WP_000889093.1.23097 WP_000889093.1.2310 WP_000889093.1.23107 WP_000889093.1.2311 WP_000889093.1.23111 WP_000889093.1.23138 WP_000889093.1.23177 WP_000889093.1.23178 WP_000889093.1.23180 WP_000889093.1.2319 WP_000889093.1.23190 WP_000889093.1.23256 WP_000889093.1.23276 WP_000889093.1.2328 WP_000889093.1.23313 WP_000889093.1.23320 WP_000889093.1.23326 WP_000889093.1.23332 WP_000889093.1.23334 WP_000889093.1.23354 WP_000889093.1.23397 WP_000889093.1.23432 WP_000889093.1.23477 WP_000889093.1.23481 WP_000889093.1.23536 WP_000889093.1.23597 WP_000889093.1.23602 WP_000889093.1.23606 WP_000889093.1.2361 WP_000889093.1.23633 WP_000889093.1.23649 WP_000889093.1.23656 WP_000889093.1.23659 WP_000889093.1.23668 WP_000889093.1.23696 WP_000889093.1.23713 WP_000889093.1.23722 WP_000889093.1.23791 WP_000889093.1.23798 WP_000889093.1.23800 WP_000889093.1.23847 WP_000889093.1.23853 WP_000889093.1.23889 WP_000889093.1.239 WP_000889093.1.23903 WP_000889093.1.23912 WP_000889093.1.23929 WP_000889093.1.23937 WP_000889093.1.23964 WP_000889093.1.23966 WP_000889093.1.23988 WP_000889093.1.23991 WP_000889093.1.24010 WP_000889093.1.24040 WP_000889093.1.24060 WP_000889093.1.24067 WP_000889093.1.24085 WP_000889093.1.24094 WP_000889093.1.24098 WP_000889093.1.24102 WP_000889093.1.24114 WP_000889093.1.24116 WP_000889093.1.24146 WP_000889093.1.24218 WP_000889093.1.24220 WP_000889093.1.24222 WP_000889093.1.24247 WP_000889093.1.24252 WP_000889093.1.24262 WP_000889093.1.24281 WP_000889093.1.24288 WP_000889093.1.2429 WP_000889093.1.24312 WP_000889093.1.24324 WP_000889093.1.24356 WP_000889093.1.24379 WP_000889093.1.24395 WP_000889093.1.24401 WP_000889093.1.24440 WP_000889093.1.24466 WP_000889093.1.24467 WP_000889093.1.24471 WP_000889093.1.24481 WP_000889093.1.24501 WP_000889093.1.24540 WP_000889093.1.24542 WP_000889093.1.24552 WP_000889093.1.24562 WP_000889093.1.24571 WP_000889093.1.24574 WP_000889093.1.2459 WP_000889093.1.24598 WP_000889093.1.2461 WP_000889093.1.24610 WP_000889093.1.24620 WP_000889093.1.24627 WP_000889093.1.24630 WP_000889093.1.24649 WP_000889093.1.2465 WP_000889093.1.24653 WP_000889093.1.24658 WP_000889093.1.24677 WP_000889093.1.24678 WP_000889093.1.24724 WP_000889093.1.24742 WP_000889093.1.24772 WP_000889093.1.24788 WP_000889093.1.24812 WP_000889093.1.24835 WP_000889093.1.24844 WP_000889093.1.24852 WP_000889093.1.24861 WP_000889093.1.24871 WP_000889093.1.249 WP_000889093.1.24928 WP_000889093.1.24943 WP_000889093.1.24970 WP_000889093.1.24989 WP_000889093.1.24993 WP_000889093.1.25005 WP_000889093.1.2503 WP_000889093.1.25061 WP_000889093.1.25084 WP_000889093.1.25121 WP_000889093.1.25153 WP_000889093.1.25155 WP_000889093.1.252 WP_000889093.1.25202 WP_000889093.1.25222 WP_000889093.1.25228 WP_000889093.1.2533 WP_000889093.1.25337 WP_000889093.1.25340 WP_000889093.1.25351 WP_000889093.1.25366 WP_000889093.1.2538 WP_000889093.1.25383 WP_000889093.1.25384 WP_000889093.1.25424 WP_000889093.1.25432 WP_000889093.1.25439 WP_000889093.1.25442 WP_000889093.1.25461 WP_000889093.1.25472 WP_000889093.1.2548 WP_000889093.1.25494 WP_000889093.1.25502 WP_000889093.1.25507 WP_000889093.1.2553 WP_000889093.1.25538 WP_000889093.1.25543 WP_000889093.1.25545 WP_000889093.1.25553 WP_000889093.1.2556 WP_000889093.1.25581 WP_000889093.1.25589 WP_000889093.1.25624 WP_000889093.1.25662 WP_000889093.1.25684 WP_000889093.1.25685 WP_000889093.1.25696 WP_000889093.1.25707 WP_000889093.1.25714 WP_000889093.1.25742 WP_000889093.1.25749 WP_000889093.1.25754 WP_000889093.1.25785 WP_000889093.1.25791 WP_000889093.1.25792 WP_000889093.1.25845 WP_000889093.1.2586 WP_000889093.1.25875 WP_000889093.1.25880 WP_000889093.1.25888 WP_000889093.1.25897 WP_000889093.1.25905 WP_000889093.1.25909 WP_000889093.1.25952 WP_000889093.1.25958 WP_000889093.1.25966 WP_000889093.1.25982 WP_000889093.1.25986 WP_000889093.1.25994 WP_000889093.1.26021 WP_000889093.1.26041 WP_000889093.1.26059 WP_000889093.1.26062 WP_000889093.1.2607 WP_000889093.1.26078 WP_000889093.1.26085 WP_000889093.1.2610 WP_000889093.1.26111 WP_000889093.1.26112 WP_000889093.1.26141 WP_000889093.1.26165 WP_000889093.1.26180 WP_000889093.1.26208 WP_000889093.1.26218 WP_000889093.1.26220 WP_000889093.1.26257 WP_000889093.1.26279 WP_000889093.1.26280 WP_000889093.1.2629 WP_000889093.1.26317 WP_000889093.1.26369 WP_000889093.1.26389 WP_000889093.1.26392 WP_000889093.1.26432 WP_000889093.1.26447 WP_000889093.1.2647 WP_000889093.1.26470 WP_000889093.1.26484 WP_000889093.1.26490 WP_000889093.1.26496 WP_000889093.1.26497 WP_000889093.1.26518 WP_000889093.1.26544 WP_000889093.1.26566 WP_000889093.1.26578 WP_000889093.1.26625 WP_000889093.1.26653 WP_000889093.1.26698 WP_000889093.1.26725 WP_000889093.1.26743 WP_000889093.1.26755 WP_000889093.1.26785 WP_000889093.1.26793 WP_000889093.1.26799 WP_000889093.1.26807 WP_000889093.1.26818 WP_000889093.1.26848 WP_000889093.1.26855 WP_000889093.1.26858 WP_000889093.1.26863 WP_000889093.1.26875 WP_000889093.1.26877 WP_000889093.1.26879 WP_000889093.1.26909 WP_000889093.1.26918 WP_000889093.1.26925 WP_000889093.1.26926 WP_000889093.1.26953 WP_000889093.1.26968 WP_000889093.1.26983 WP_000889093.1.26985 WP_000889093.1.26988 WP_000889093.1.26990 WP_000889093.1.26994 WP_000889093.1.27001 WP_000889093.1.27007 WP_000889093.1.27022 WP_000889093.1.2703 WP_000889093.1.27046 WP_000889093.1.27047 WP_000889093.1.27071 WP_000889093.1.27076 WP_000889093.1.27078 WP_000889093.1.27082 WP_000889093.1.27119 WP_000889093.1.27131 WP_000889093.1.27135 WP_000889093.1.27149 WP_000889093.1.27151 WP_000889093.1.27174 WP_000889093.1.27203 WP_000889093.1.2721 WP_000889093.1.27210 WP_000889093.1.27219 WP_000889093.1.2724 WP_000889093.1.27249 WP_000889093.1.27252 WP_000889093.1.27267 WP_000889093.1.2729 WP_000889093.1.27308 WP_000889093.1.27312 WP_000889093.1.27315 WP_000889093.1.27324 WP_000889093.1.27347 WP_000889093.1.2735 WP_000889093.1.27362 WP_000889093.1.27382 WP_000889093.1.27392 WP_000889093.1.27405 WP_000889093.1.27421 WP_000889093.1.27428 WP_000889093.1.27432 WP_000889093.1.27440 WP_000889093.1.27478 WP_000889093.1.27484 WP_000889093.1.2750 WP_000889093.1.27514 WP_000889093.1.27573 WP_000889093.1.27581 WP_000889093.1.27589 WP_000889093.1.276 WP_000889093.1.27601 WP_000889093.1.27636 WP_000889093.1.27653 WP_000889093.1.27661 WP_000889093.1.27684 WP_000889093.1.27686 WP_000889093.1.27690 WP_000889093.1.27714 WP_000889093.1.27721 WP_000889093.1.27740 WP_000889093.1.27746 WP_000889093.1.27768 WP_000889093.1.27789 WP_000889093.1.27791 WP_000889093.1.27808 WP_000889093.1.27853 WP_000889093.1.27862 WP_000889093.1.27865 WP_000889093.1.27886 WP_000889093.1.27904 WP_000889093.1.27907 WP_000889093.1.2791 WP_000889093.1.27912 WP_000889093.1.27917 WP_000889093.1.27964 WP_000889093.1.27984 WP_000889093.1.27988 WP_000889093.1.28014 WP_000889093.1.28028 WP_000889093.1.28050 WP_000889093.1.28058 WP_000889093.1.28068 WP_000889093.1.28069 WP_000889093.1.28104 WP_000889093.1.28121 WP_000889093.1.28140 WP_000889093.1.28146 WP_000889093.1.28162 WP_000889093.1.28164 WP_000889093.1.28183 WP_000889093.1.28228 WP_000889093.1.28231 WP_000889093.1.28259 WP_000889093.1.28264 WP_000889093.1.2827 WP_000889093.1.28296 WP_000889093.1.2830 WP_000889093.1.28307 WP_000889093.1.28350 WP_000889093.1.28351 WP_000889093.1.28353 WP_000889093.1.28379 WP_000889093.1.28408 WP_000889093.1.28458 WP_000889093.1.28460 WP_000889093.1.28519 WP_000889093.1.28522 WP_000889093.1.28531 WP_000889093.1.28537 WP_000889093.1.28542 WP_000889093.1.28549 WP_000889093.1.28574 WP_000889093.1.28604 WP_000889093.1.28608 WP_000889093.1.2861 WP_000889093.1.28643 WP_000889093.1.28667 WP_000889093.1.2868 WP_000889093.1.28680 WP_000889093.1.28708 WP_000889093.1.28709 WP_000889093.1.28740 WP_000889093.1.28746 WP_000889093.1.28761 WP_000889093.1.28767 WP_000889093.1.28771 WP_000889093.1.28772 WP_000889093.1.28790 WP_000889093.1.28812 WP_000889093.1.28816 WP_000889093.1.2882 WP_000889093.1.28834 WP_000889093.1.28836 WP_000889093.1.28846 WP_000889093.1.28867 WP_000889093.1.28868 WP_000889093.1.28869 WP_000889093.1.2888 WP_000889093.1.28892 WP_000889093.1.28931 WP_000889093.1.28945 WP_000889093.1.28997 WP_000889093.1.2900 WP_000889093.1.29009 WP_000889093.1.29018 WP_000889093.1.29039 WP_000889093.1.29041 WP_000889093.1.29046 WP_000889093.1.29069 WP_000889093.1.29076 WP_000889093.1.2909 WP_000889093.1.29098 WP_000889093.1.29104 WP_000889093.1.29105 WP_000889093.1.2911 WP_000889093.1.29175 WP_000889093.1.29181 WP_000889093.1.29192 WP_000889093.1.292 WP_000889093.1.29204 WP_000889093.1.29205 WP_000889093.1.29210 WP_000889093.1.29222 WP_000889093.1.29232 WP_000889093.1.29249 WP_000889093.1.29253 WP_000889093.1.29266 WP_000889093.1.29269 WP_000889093.1.29280 WP_000889093.1.29286 WP_000889093.1.29289 WP_000889093.1.29300 WP_000889093.1.29311 WP_000889093.1.29317 WP_000889093.1.29323 WP_000889093.1.29326 WP_000889093.1.29338 WP_000889093.1.29343 WP_000889093.1.29351 WP_000889093.1.29357 WP_000889093.1.29360 WP_000889093.1.2940 WP_000889093.1.29406 WP_000889093.1.29442 WP_000889093.1.29469 WP_000889093.1.29473 WP_000889093.1.295 WP_000889093.1.2951 WP_000889093.1.29517 WP_000889093.1.29536 WP_000889093.1.29549 WP_000889093.1.29572 WP_000889093.1.29624 WP_000889093.1.29626 WP_000889093.1.29628 WP_000889093.1.29642 WP_000889093.1.29653 WP_000889093.1.29655 WP_000889093.1.2966 WP_000889093.1.29694 WP_000889093.1.2970 WP_000889093.1.29712 WP_000889093.1.29730 WP_000889093.1.29734 WP_000889093.1.29810 WP_000889093.1.29828 WP_000889093.1.29852 WP_000889093.1.29868 WP_000889093.1.29881 WP_000889093.1.29921 WP_000889093.1.29929 WP_000889093.1.29940 WP_000889093.1.29944 WP_000889093.1.29980 WP_000889093.1.29996 WP_000889093.1.30011 WP_000889093.1.30038 WP_000889093.1.30055 WP_000889093.1.30065 WP_000889093.1.30066 WP_000889093.1.3008 WP_000889093.1.3011 WP_000889093.1.30119 WP_000889093.1.30133 WP_000889093.1.30143 WP_000889093.1.30151 WP_000889093.1.30167 WP_000889093.1.3019 WP_000889093.1.30199 WP_000889093.1.30205 WP_000889093.1.30219 WP_000889093.1.30229 WP_000889093.1.30234 WP_000889093.1.30243 WP_000889093.1.30245 WP_000889093.1.30250 WP_000889093.1.30255 WP_000889093.1.30287 WP_000889093.1.30295 WP_000889093.1.30297 WP_000889093.1.30301 WP_000889093.1.30305 WP_000889093.1.30306 WP_000889093.1.30316 WP_000889093.1.30335 WP_000889093.1.30342 WP_000889093.1.30370 WP_000889093.1.30387 WP_000889093.1.3040 WP_000889093.1.30405 WP_000889093.1.30406 WP_000889093.1.30435 WP_000889093.1.30443 WP_000889093.1.30446 WP_000889093.1.30480 WP_000889093.1.30481 WP_000889093.1.30487 WP_000889093.1.30514 WP_000889093.1.30538 WP_000889093.1.30545 WP_000889093.1.30549 WP_000889093.1.30553 WP_000889093.1.30561 WP_000889093.1.30564 WP_000889093.1.3058 WP_000889093.1.30588 WP_000889093.1.30591 WP_000889093.1.30607 WP_000889093.1.3061 WP_000889093.1.30612 WP_000889093.1.30647 WP_000889093.1.30672 WP_000889093.1.30676 WP_000889093.1.30695 WP_000889093.1.30705 WP_000889093.1.30711 WP_000889093.1.30724 WP_000889093.1.30755 WP_000889093.1.30757 WP_000889093.1.30770 WP_000889093.1.30795 WP_000889093.1.3084 WP_000889093.1.3085 WP_000889093.1.30864 WP_000889093.1.30865 WP_000889093.1.30869 WP_000889093.1.30891 WP_000889093.1.30923 WP_000889093.1.30942 WP_000889093.1.30948 WP_000889093.1.30956 WP_000889093.1.3096 WP_000889093.1.30964 WP_000889093.1.30982 WP_000889093.1.30984 WP_000889093.1.31004 WP_000889093.1.31031 WP_000889093.1.3105 WP_000889093.1.31059 WP_000889093.1.31082 WP_000889093.1.31099 WP_000889093.1.31134 WP_000889093.1.31164 WP_000889093.1.31169 WP_000889093.1.31191 WP_000889093.1.31216 WP_000889093.1.31218 WP_000889093.1.31256 WP_000889093.1.31275 WP_000889093.1.31283 WP_000889093.1.31322 WP_000889093.1.31334 WP_000889093.1.31367 WP_000889093.1.31383 WP_000889093.1.31394 WP_000889093.1.31420 WP_000889093.1.31427 WP_000889093.1.31439 WP_000889093.1.31443 WP_000889093.1.31456 WP_000889093.1.31464 WP_000889093.1.31466 WP_000889093.1.31473 WP_000889093.1.31488 WP_000889093.1.31493 WP_000889093.1.31499 WP_000889093.1.3152 WP_000889093.1.31522 WP_000889093.1.31528 WP_000889093.1.31545 WP_000889093.1.3155 WP_000889093.1.31550 WP_000889093.1.31553 WP_000889093.1.3156 WP_000889093.1.31566 WP_000889093.1.31574 WP_000889093.1.31586 WP_000889093.1.3161 WP_000889093.1.31619 WP_000889093.1.31620 WP_000889093.1.31650 WP_000889093.1.31651 WP_000889093.1.31652 WP_000889093.1.31688 WP_000889093.1.31695 WP_000889093.1.31735 WP_000889093.1.31755 WP_000889093.1.31757 WP_000889093.1.31759 WP_000889093.1.31767 WP_000889093.1.3178 WP_000889093.1.31780 WP_000889093.1.31822 WP_000889093.1.31847 WP_000889093.1.31859 WP_000889093.1.31876 WP_000889093.1.31887 WP_000889093.1.3191 WP_000889093.1.31912 WP_000889093.1.31915 WP_000889093.1.31935 WP_000889093.1.31975 WP_000889093.1.31979 WP_000889093.1.31989 WP_000889093.1.31996 WP_000889093.1.320 WP_000889093.1.32032 WP_000889093.1.32035 WP_000889093.1.32058 WP_000889093.1.32068 WP_000889093.1.32079 WP_000889093.1.32080 WP_000889093.1.32083 WP_000889093.1.32097 WP_000889093.1.32108 WP_000889093.1.3211 WP_000889093.1.32110 WP_000889093.1.32128 WP_000889093.1.32139 WP_000889093.1.32171 WP_000889093.1.32186 WP_000889093.1.32187 WP_000889093.1.3221 WP_000889093.1.32233 WP_000889093.1.32261 WP_000889093.1.32280 WP_000889093.1.32282 WP_000889093.1.32290 WP_000889093.1.32303 WP_000889093.1.32310 WP_000889093.1.32313 WP_000889093.1.32320 WP_000889093.1.32334 WP_000889093.1.32344 WP_000889093.1.32347 WP_000889093.1.32351 WP_000889093.1.32389 WP_000889093.1.32391 WP_000889093.1.32397 WP_000889093.1.3241 WP_000889093.1.32419 WP_000889093.1.32439 WP_000889093.1.32444 WP_000889093.1.32462 WP_000889093.1.32485 WP_000889093.1.32507 WP_000889093.1.3255 WP_000889093.1.32550 WP_000889093.1.32567 WP_000889093.1.32642 WP_000889093.1.32644 WP_000889093.1.32667 WP_000889093.1.32688 WP_000889093.1.32689 WP_000889093.1.32696 WP_000889093.1.32701 WP_000889093.1.32717 WP_000889093.1.32719 WP_000889093.1.32734 WP_000889093.1.32735 WP_000889093.1.32771 WP_000889093.1.32774 WP_000889093.1.32792 WP_000889093.1.32794 WP_000889093.1.32807 WP_000889093.1.32808 WP_000889093.1.32816 WP_000889093.1.32820 WP_000889093.1.32850 WP_000889093.1.32876 WP_000889093.1.32877 WP_000889093.1.32892 WP_000889093.1.32906 WP_000889093.1.32924 WP_000889093.1.32986 WP_000889093.1.32994 WP_000889093.1.33001 WP_000889093.1.33005 WP_000889093.1.33020 WP_000889093.1.33021 WP_000889093.1.33034 WP_000889093.1.33070 WP_000889093.1.33091 WP_000889093.1.33100 WP_000889093.1.33113 WP_000889093.1.33128 WP_000889093.1.33135 WP_000889093.1.33159 WP_000889093.1.33166 WP_000889093.1.33180 WP_000889093.1.33181 WP_000889093.1.33188 WP_000889093.1.3319 WP_000889093.1.33233 WP_000889093.1.33259 WP_000889093.1.33271 WP_000889093.1.33286 WP_000889093.1.33291 WP_000889093.1.33312 WP_000889093.1.33334 WP_000889093.1.33361 WP_000889093.1.33378 WP_000889093.1.33430 WP_000889093.1.33433 WP_000889093.1.33436 WP_000889093.1.33437 WP_000889093.1.33451 WP_000889093.1.33454 WP_000889093.1.33458 WP_000889093.1.33511 WP_000889093.1.33527 WP_000889093.1.33528 WP_000889093.1.33559 WP_000889093.1.33570 WP_000889093.1.33578 WP_000889093.1.33589 WP_000889093.1.3359 WP_000889093.1.33634 WP_000889093.1.33637 WP_000889093.1.33666 WP_000889093.1.33674 WP_000889093.1.33709 WP_000889093.1.33710 WP_000889093.1.33727 WP_000889093.1.33749 WP_000889093.1.3375 WP_000889093.1.33758 WP_000889093.1.33781 WP_000889093.1.33788 WP_000889093.1.33791 WP_000889093.1.33807 WP_000889093.1.33808 WP_000889093.1.33815 WP_000889093.1.3384 WP_000889093.1.33859 WP_000889093.1.33862 WP_000889093.1.33874 WP_000889093.1.33878 WP_000889093.1.33881 WP_000889093.1.33882 WP_000889093.1.33891 WP_000889093.1.33897 WP_000889093.1.33908 WP_000889093.1.33933 WP_000889093.1.33956 WP_000889093.1.34007 WP_000889093.1.34015 WP_000889093.1.34028 WP_000889093.1.34041 WP_000889093.1.34047 WP_000889093.1.34054 WP_000889093.1.34083 WP_000889093.1.3409 WP_000889093.1.34120 WP_000889093.1.34162 WP_000889093.1.34171 WP_000889093.1.34176 WP_000889093.1.34177 WP_000889093.1.34196 WP_000889093.1.34212 WP_000889093.1.34262 WP_000889093.1.34272 WP_000889093.1.34291 WP_000889093.1.34301 WP_000889093.1.34309 WP_000889093.1.34327 WP_000889093.1.34335 WP_000889093.1.3437 WP_000889093.1.34375 WP_000889093.1.34378 WP_000889093.1.34449 WP_000889093.1.34466 WP_000889093.1.34474 WP_000889093.1.34503 WP_000889093.1.34506 WP_000889093.1.34508 WP_000889093.1.34509 WP_000889093.1.34519 WP_000889093.1.34522 WP_000889093.1.34559 WP_000889093.1.34586 WP_000889093.1.34598 WP_000889093.1.34601 WP_000889093.1.34603 WP_000889093.1.34616 WP_000889093.1.34627 WP_000889093.1.3464 WP_000889093.1.34651 WP_000889093.1.34662 WP_000889093.1.34674 WP_000889093.1.34690 WP_000889093.1.34699 WP_000889093.1.34713 WP_000889093.1.34739 WP_000889093.1.34742 WP_000889093.1.34746 WP_000889093.1.34754 WP_000889093.1.34772 WP_000889093.1.34785 WP_000889093.1.34787 WP_000889093.1.34792 WP_000889093.1.34796 WP_000889093.1.34809 WP_000889093.1.34839 WP_000889093.1.34848 WP_000889093.1.34879 WP_000889093.1.3488 WP_000889093.1.34886 WP_000889093.1.34899 WP_000889093.1.3494 WP_000889093.1.3496 WP_000889093.1.34973 WP_000889093.1.34995 WP_000889093.1.3502 WP_000889093.1.35020 WP_000889093.1.35027 WP_000889093.1.35034 WP_000889093.1.35042 WP_000889093.1.35064 WP_000889093.1.35076 WP_000889093.1.35098 WP_000889093.1.35103 WP_000889093.1.35117 WP_000889093.1.35124 WP_000889093.1.35133 WP_000889093.1.35152 WP_000889093.1.35157 WP_000889093.1.35167 WP_000889093.1.35178 WP_000889093.1.35217 WP_000889093.1.35218 WP_000889093.1.35232 WP_000889093.1.35248 WP_000889093.1.35254 WP_000889093.1.3530 WP_000889093.1.35305 WP_000889093.1.3532 WP_000889093.1.35358 WP_000889093.1.3537 WP_000889093.1.35380 WP_000889093.1.35383 WP_000889093.1.35392 WP_000889093.1.35406 WP_000889093.1.35411 WP_000889093.1.35432 WP_000889093.1.35447 WP_000889093.1.35458 WP_000889093.1.35459 WP_000889093.1.35482 WP_000889093.1.35521 WP_000889093.1.35528 WP_000889093.1.35541 WP_000889093.1.35597 WP_000889093.1.35616 WP_000889093.1.35625 WP_000889093.1.35634 WP_000889093.1.35685 WP_000889093.1.35702 WP_000889093.1.3571 WP_000889093.1.35721 WP_000889093.1.35735 WP_000889093.1.35743 WP_000889093.1.35763 WP_000889093.1.35773 WP_000889093.1.35776 WP_000889093.1.35834 WP_000889093.1.35836 WP_000889093.1.3585 WP_000889093.1.35851 WP_000889093.1.35882 WP_000889093.1.35905 WP_000889093.1.35919 WP_000889093.1.35920 WP_000889093.1.35924 WP_000889093.1.35925 WP_000889093.1.35932 WP_000889093.1.35943 WP_000889093.1.35957 WP_000889093.1.3596 WP_000889093.1.35967 WP_000889093.1.35972 WP_000889093.1.35974 WP_000889093.1.35981 WP_000889093.1.35986 WP_000889093.1.36002 WP_000889093.1.36054 WP_000889093.1.36060 WP_000889093.1.36077 WP_000889093.1.36090 WP_000889093.1.36109 WP_000889093.1.36124 WP_000889093.1.36131 WP_000889093.1.36139 WP_000889093.1.36144 WP_000889093.1.3616 WP_000889093.1.36160 WP_000889093.1.36162 WP_000889093.1.36167 WP_000889093.1.3618 WP_000889093.1.36200 WP_000889093.1.36206 WP_000889093.1.3621 WP_000889093.1.36214 WP_000889093.1.36230 WP_000889093.1.36242 WP_000889093.1.36247 WP_000889093.1.36272 WP_000889093.1.36300 WP_000889093.1.36317 WP_000889093.1.36377 WP_000889093.1.36382 WP_000889093.1.36404 WP_000889093.1.36411 WP_000889093.1.36429 WP_000889093.1.36448 WP_000889093.1.36450 WP_000889093.1.3646 WP_000889093.1.36463 WP_000889093.1.36471 WP_000889093.1.36479 WP_000889093.1.36486 WP_000889093.1.36492 WP_000889093.1.36538 WP_000889093.1.36546 WP_000889093.1.36552 WP_000889093.1.36554 WP_000889093.1.36568 WP_000889093.1.36629 WP_000889093.1.36641 WP_000889093.1.36651 WP_000889093.1.36653 WP_000889093.1.36688 WP_000889093.1.367 WP_000889093.1.36715 WP_000889093.1.3674 WP_000889093.1.36741 WP_000889093.1.36750 WP_000889093.1.36757 WP_000889093.1.36780 WP_000889093.1.36789 WP_000889093.1.36795 WP_000889093.1.36867 WP_000889093.1.36923 WP_000889093.1.36943 WP_000889093.1.36961 WP_000889093.1.36965 WP_000889093.1.36972 WP_000889093.1.36982 WP_000889093.1.36993 WP_000889093.1.36994 WP_000889093.1.36999 WP_000889093.1.37022 WP_000889093.1.37024 WP_000889093.1.37033 WP_000889093.1.37034 WP_000889093.1.3705 WP_000889093.1.37062 WP_000889093.1.37068 WP_000889093.1.37115 WP_000889093.1.37118 WP_000889093.1.37136 WP_000889093.1.37138 WP_000889093.1.37154 WP_000889093.1.37156 WP_000889093.1.37164 WP_000889093.1.37166 WP_000889093.1.37170 WP_000889093.1.37194 WP_000889093.1.37205 WP_000889093.1.37209 WP_000889093.1.37243 WP_000889093.1.37246 WP_000889093.1.37250 WP_000889093.1.37282 WP_000889093.1.37283 WP_000889093.1.37289 WP_000889093.1.37294 WP_000889093.1.37300 WP_000889093.1.37301 WP_000889093.1.37324 WP_000889093.1.37340 WP_000889093.1.37346 WP_000889093.1.37357 WP_000889093.1.37390 WP_000889093.1.37415 WP_000889093.1.37443 WP_000889093.1.37447 WP_000889093.1.37450 WP_000889093.1.37457 WP_000889093.1.37488 WP_000889093.1.37508 WP_000889093.1.37511 WP_000889093.1.37522 WP_000889093.1.37526 WP_000889093.1.37540 WP_000889093.1.37541 WP_000889093.1.37575 WP_000889093.1.37599 WP_000889093.1.37611 WP_000889093.1.37615 WP_000889093.1.37623 WP_000889093.1.37629 WP_000889093.1.3763 WP_000889093.1.37640 WP_000889093.1.37684 WP_000889093.1.37707 WP_000889093.1.37713 WP_000889093.1.37714 WP_000889093.1.37767 WP_000889093.1.37790 WP_000889093.1.37827 WP_000889093.1.37837 WP_000889093.1.37840 WP_000889093.1.37854 WP_000889093.1.37858 WP_000889093.1.37876 WP_000889093.1.37921 WP_000889093.1.37944 WP_000889093.1.37947 WP_000889093.1.37989 WP_000889093.1.38014 WP_000889093.1.38029 WP_000889093.1.38065 WP_000889093.1.38093 WP_000889093.1.38109 WP_000889093.1.38161 WP_000889093.1.38180 WP_000889093.1.38184 WP_000889093.1.38213 WP_000889093.1.38220 WP_000889093.1.38238 WP_000889093.1.38268 WP_000889093.1.38275 WP_000889093.1.38283 WP_000889093.1.38294 WP_000889093.1.3830 WP_000889093.1.38324 WP_000889093.1.38334 WP_000889093.1.38355 WP_000889093.1.38374 WP_000889093.1.38429 WP_000889093.1.3844 WP_000889093.1.38497 WP_000889093.1.38503 WP_000889093.1.38506 WP_000889093.1.38507 WP_000889093.1.38521 WP_000889093.1.38542 WP_000889093.1.38543 WP_000889093.1.38560 WP_000889093.1.38573 WP_000889093.1.38588 WP_000889093.1.38602 WP_000889093.1.3864 WP_000889093.1.38640 WP_000889093.1.38643 WP_000889093.1.38647 WP_000889093.1.38665 WP_000889093.1.38675 WP_000889093.1.38676 WP_000889093.1.38685 WP_000889093.1.38697 WP_000889093.1.387 WP_000889093.1.38712 WP_000889093.1.38718 WP_000889093.1.38723 WP_000889093.1.38738 WP_000889093.1.38742 WP_000889093.1.3876 WP_000889093.1.38765 WP_000889093.1.3877 WP_000889093.1.38770 WP_000889093.1.38778 WP_000889093.1.38796 WP_000889093.1.38805 WP_000889093.1.3882 WP_000889093.1.38825 WP_000889093.1.3883 WP_000889093.1.3885 WP_000889093.1.38851 WP_000889093.1.38861 WP_000889093.1.38868 WP_000889093.1.38887 WP_000889093.1.38892 WP_000889093.1.38906 WP_000889093.1.38914 WP_000889093.1.38918 WP_000889093.1.38930 WP_000889093.1.38934 WP_000889093.1.38949 WP_000889093.1.38955 WP_000889093.1.38957 WP_000889093.1.3897 WP_000889093.1.3899 WP_000889093.1.39006 WP_000889093.1.39033 WP_000889093.1.39051 WP_000889093.1.39071 WP_000889093.1.39074 WP_000889093.1.39076 WP_000889093.1.39079 WP_000889093.1.39083 WP_000889093.1.39087 WP_000889093.1.39091 WP_000889093.1.39093 WP_000889093.1.39097 WP_000889093.1.39098 WP_000889093.1.39104 WP_000889093.1.39121 WP_000889093.1.39124 WP_000889093.1.39133 WP_000889093.1.39139 WP_000889093.1.39151 WP_000889093.1.3917 WP_000889093.1.39189 WP_000889093.1.39192 WP_000889093.1.39198 WP_000889093.1.392 WP_000889093.1.39219 WP_000889093.1.39227 WP_000889093.1.39243 WP_000889093.1.39270 WP_000889093.1.3928 WP_000889093.1.39318 WP_000889093.1.39320 WP_000889093.1.39321 WP_000889093.1.39322 WP_000889093.1.39336 WP_000889093.1.39337 WP_000889093.1.39339 WP_000889093.1.3934 WP_000889093.1.39343 WP_000889093.1.39357 WP_000889093.1.39387 WP_000889093.1.39404 WP_000889093.1.39412 WP_000889093.1.39421 WP_000889093.1.39431 WP_000889093.1.39443 WP_000889093.1.39453 WP_000889093.1.39454 WP_000889093.1.39479 WP_000889093.1.3948 WP_000889093.1.395 WP_000889093.1.39505 WP_000889093.1.39511 WP_000889093.1.39518 WP_000889093.1.39533 WP_000889093.1.39568 WP_000889093.1.39569 WP_000889093.1.39570 WP_000889093.1.39591 WP_000889093.1.39596 WP_000889093.1.39597 WP_000889093.1.39648 WP_000889093.1.3966 WP_000889093.1.39663 WP_000889093.1.39710 WP_000889093.1.39716 WP_000889093.1.39731 WP_000889093.1.39754 WP_000889093.1.39813 WP_000889093.1.39824 WP_000889093.1.39828 WP_000889093.1.39833 WP_000889093.1.39865 WP_000889093.1.39872 WP_000889093.1.39931 WP_000889093.1.39944 WP_000889093.1.39948 WP_000889093.1.39964 WP_000889093.1.39978 WP_000889093.1.39985 WP_000889093.1.39990 WP_000889093.1.400 WP_000889093.1.40003 WP_000889093.1.40005 WP_000889093.1.40007 WP_000889093.1.40018 WP_000889093.1.40022 WP_000889093.1.40023 WP_000889093.1.40027 WP_000889093.1.40050 WP_000889093.1.4008 WP_000889093.1.40092 WP_000889093.1.40112 WP_000889093.1.40117 WP_000889093.1.40118 WP_000889093.1.40128 WP_000889093.1.4017 WP_000889093.1.40176 WP_000889093.1.40216 WP_000889093.1.4023 WP_000889093.1.40239 WP_000889093.1.40251 WP_000889093.1.40269 WP_000889093.1.40274 WP_000889093.1.40290 WP_000889093.1.40296 WP_000889093.1.40303 WP_000889093.1.40327 WP_000889093.1.40333 WP_000889093.1.40347 WP_000889093.1.40362 WP_000889093.1.40365 WP_000889093.1.40393 WP_000889093.1.40400 WP_000889093.1.4044 WP_000889093.1.40457 WP_000889093.1.40479 WP_000889093.1.40515 WP_000889093.1.40526 WP_000889093.1.40558 WP_000889093.1.40566 WP_000889093.1.40568 WP_000889093.1.40574 WP_000889093.1.40578 WP_000889093.1.4059 WP_000889093.1.40626 WP_000889093.1.40642 WP_000889093.1.40682 WP_000889093.1.40696 WP_000889093.1.4070 WP_000889093.1.40714 WP_000889093.1.4073 WP_000889093.1.40730 WP_000889093.1.40733 WP_000889093.1.40736 WP_000889093.1.40737 WP_000889093.1.40739 WP_000889093.1.40746 WP_000889093.1.40754 WP_000889093.1.40767 WP_000889093.1.40801 WP_000889093.1.40826 WP_000889093.1.4084 WP_000889093.1.40850 WP_000889093.1.40879 WP_000889093.1.40883 WP_000889093.1.40887 WP_000889093.1.40889 WP_000889093.1.40928 WP_000889093.1.40931 WP_000889093.1.4094 WP_000889093.1.40958 WP_000889093.1.40960 WP_000889093.1.40968 WP_000889093.1.40971 WP_000889093.1.40982 WP_000889093.1.40985 WP_000889093.1.40986 WP_000889093.1.41008 WP_000889093.1.41010 WP_000889093.1.41012 WP_000889093.1.41019 WP_000889093.1.41021 WP_000889093.1.41025 WP_000889093.1.41040 WP_000889093.1.41047 WP_000889093.1.41068 WP_000889093.1.41071 WP_000889093.1.4111 WP_000889093.1.41138 WP_000889093.1.41162 WP_000889093.1.4117 WP_000889093.1.41186 WP_000889093.1.41203 WP_000889093.1.41209 WP_000889093.1.41267 WP_000889093.1.41268 WP_000889093.1.41275 WP_000889093.1.41278 WP_000889093.1.4128 WP_000889093.1.41306 WP_000889093.1.41309 WP_000889093.1.41319 WP_000889093.1.41327 WP_000889093.1.4133 WP_000889093.1.41360 WP_000889093.1.41366 WP_000889093.1.41387 WP_000889093.1.41388 WP_000889093.1.41450 WP_000889093.1.4147 WP_000889093.1.41475 WP_000889093.1.41476 WP_000889093.1.41508 WP_000889093.1.4152 WP_000889093.1.41523 WP_000889093.1.41527 WP_000889093.1.41551 WP_000889093.1.41586 WP_000889093.1.41594 WP_000889093.1.41652 WP_000889093.1.41673 WP_000889093.1.41684 WP_000889093.1.41697 WP_000889093.1.417 WP_000889093.1.41709 WP_000889093.1.41737 WP_000889093.1.41756 WP_000889093.1.41757 WP_000889093.1.41763 WP_000889093.1.41775 WP_000889093.1.41787 WP_000889093.1.41801 WP_000889093.1.41811 WP_000889093.1.41823 WP_000889093.1.41827 WP_000889093.1.41850 WP_000889093.1.41858 WP_000889093.1.41892 WP_000889093.1.41914 WP_000889093.1.41927 WP_000889093.1.41937 WP_000889093.1.41952 WP_000889093.1.41958 WP_000889093.1.41961 WP_000889093.1.41986 WP_000889093.1.4201 WP_000889093.1.42021 WP_000889093.1.42024 WP_000889093.1.42030 WP_000889093.1.42076 WP_000889093.1.42086 WP_000889093.1.42099 WP_000889093.1.42106 WP_000889093.1.42121 WP_000889093.1.42140 WP_000889093.1.42149 WP_000889093.1.42173 WP_000889093.1.42195 WP_000889093.1.42199 WP_000889093.1.42232 WP_000889093.1.42234 WP_000889093.1.42245 WP_000889093.1.42266 WP_000889093.1.42291 WP_000889093.1.4230 WP_000889093.1.42303 WP_000889093.1.42315 WP_000889093.1.42331 WP_000889093.1.42337 WP_000889093.1.42348 WP_000889093.1.42358 WP_000889093.1.4238 WP_000889093.1.42386 WP_000889093.1.424 WP_000889093.1.42437 WP_000889093.1.42450 WP_000889093.1.42470 WP_000889093.1.42500 WP_000889093.1.4252 WP_000889093.1.42528 WP_000889093.1.42536 WP_000889093.1.42538 WP_000889093.1.42566 WP_000889093.1.42625 WP_000889093.1.42642 WP_000889093.1.42654 WP_000889093.1.42715 WP_000889093.1.42741 WP_000889093.1.42743 WP_000889093.1.42760 WP_000889093.1.42792 WP_000889093.1.42807 WP_000889093.1.42817 WP_000889093.1.42820 WP_000889093.1.42825 WP_000889093.1.4283 WP_000889093.1.42846 WP_000889093.1.4285 WP_000889093.1.42911 WP_000889093.1.42933 WP_000889093.1.42935 WP_000889093.1.42960 WP_000889093.1.42964 WP_000889093.1.42965 WP_000889093.1.42969 WP_000889093.1.43012 WP_000889093.1.43015 WP_000889093.1.43017 WP_000889093.1.4302 WP_000889093.1.43029 WP_000889093.1.43046 WP_000889093.1.43051 WP_000889093.1.43059 WP_000889093.1.43066 WP_000889093.1.4307 WP_000889093.1.43074 WP_000889093.1.43085 WP_000889093.1.43109 WP_000889093.1.43119 WP_000889093.1.43150 WP_000889093.1.4317 WP_000889093.1.43186 WP_000889093.1.43191 WP_000889093.1.43192 WP_000889093.1.43197 WP_000889093.1.4320 WP_000889093.1.43207 WP_000889093.1.43210 WP_000889093.1.43219 WP_000889093.1.43229 WP_000889093.1.43289 WP_000889093.1.43294 WP_000889093.1.43302 WP_000889093.1.43329 WP_000889093.1.43343 WP_000889093.1.43344 WP_000889093.1.43345 WP_000889093.1.43347 WP_000889093.1.43361 WP_000889093.1.43367 WP_000889093.1.43377 WP_000889093.1.434 WP_000889093.1.4340 WP_000889093.1.43423 WP_000889093.1.43426 WP_000889093.1.43440 WP_000889093.1.43443 WP_000889093.1.43453 WP_000889093.1.43464 WP_000889093.1.43467 WP_000889093.1.43479 WP_000889093.1.43499 WP_000889093.1.43503 WP_000889093.1.43511 WP_000889093.1.43516 WP_000889093.1.43518 WP_000889093.1.43527 WP_000889093.1.43529 WP_000889093.1.43537 WP_000889093.1.43539 WP_000889093.1.43558 WP_000889093.1.4358 WP_000889093.1.43580 WP_000889093.1.43634 WP_000889093.1.4364 WP_000889093.1.4366 WP_000889093.1.43661 WP_000889093.1.43698 WP_000889093.1.43705 WP_000889093.1.43714 WP_000889093.1.43739 WP_000889093.1.43757 WP_000889093.1.43771 WP_000889093.1.43792 WP_000889093.1.43793 WP_000889093.1.43900 WP_000889093.1.43906 WP_000889093.1.43910 WP_000889093.1.43932 WP_000889093.1.43934 WP_000889093.1.43979 WP_000889093.1.44003 WP_000889093.1.44019 WP_000889093.1.44022 WP_000889093.1.44024 WP_000889093.1.44073 WP_000889093.1.4409 WP_000889093.1.44091 WP_000889093.1.44127 WP_000889093.1.44131 WP_000889093.1.44135 WP_000889093.1.44138 WP_000889093.1.44145 WP_000889093.1.44156 WP_000889093.1.44176 WP_000889093.1.4420 WP_000889093.1.44209 WP_000889093.1.44227 WP_000889093.1.4425 WP_000889093.1.4429 WP_000889093.1.44293 WP_000889093.1.44295 WP_000889093.1.44303 WP_000889093.1.44306 WP_000889093.1.44328 WP_000889093.1.44329 WP_000889093.1.44335 WP_000889093.1.44356 WP_000889093.1.44379 WP_000889093.1.44387 WP_000889093.1.44399 WP_000889093.1.44400 WP_000889093.1.44402 WP_000889093.1.44403 WP_000889093.1.44413 WP_000889093.1.4442 WP_000889093.1.44421 WP_000889093.1.44439 WP_000889093.1.44462 WP_000889093.1.44473 WP_000889093.1.44487 WP_000889093.1.44496 WP_000889093.1.44498 WP_000889093.1.44512 WP_000889093.1.44533 WP_000889093.1.44550 WP_000889093.1.4456 WP_000889093.1.44574 WP_000889093.1.44584 WP_000889093.1.44595 WP_000889093.1.44601 WP_000889093.1.44616 WP_000889093.1.44643 WP_000889093.1.44644 WP_000889093.1.44647 WP_000889093.1.44681 WP_000889093.1.44682 WP_000889093.1.44683 WP_000889093.1.44695 WP_000889093.1.44764 WP_000889093.1.44789 WP_000889093.1.44844 WP_000889093.1.44850 WP_000889093.1.44859 WP_000889093.1.44872 WP_000889093.1.44885 WP_000889093.1.44890 WP_000889093.1.44894 WP_000889093.1.44904 WP_000889093.1.4491 WP_000889093.1.44921 WP_000889093.1.44937 WP_000889093.1.44938 WP_000889093.1.44987 WP_000889093.1.44995 WP_000889093.1.45006 WP_000889093.1.45021 WP_000889093.1.45023 WP_000889093.1.45078 WP_000889093.1.45082 WP_000889093.1.45087 WP_000889093.1.45109 WP_000889093.1.45118 WP_000889093.1.4512 WP_000889093.1.45120 WP_000889093.1.45148 WP_000889093.1.45166 WP_000889093.1.45179 WP_000889093.1.45187 WP_000889093.1.45196 WP_000889093.1.45207 WP_000889093.1.45220 WP_000889093.1.45222 WP_000889093.1.45225 WP_000889093.1.4525 WP_000889093.1.45266 WP_000889093.1.45283 WP_000889093.1.45287 WP_000889093.1.45325 WP_000889093.1.45357 WP_000889093.1.4536 WP_000889093.1.45378 WP_000889093.1.45408 WP_000889093.1.45417 WP_000889093.1.4543 WP_000889093.1.45476 WP_000889093.1.45481 WP_000889093.1.45505 WP_000889093.1.45506 WP_000889093.1.45528 WP_000889093.1.45531 WP_000889093.1.4556 WP_000889093.1.45572 WP_000889093.1.4559 WP_000889093.1.45601 WP_000889093.1.45612 WP_000889093.1.45623 WP_000889093.1.45652 WP_000889093.1.4566 WP_000889093.1.45673 WP_000889093.1.45688 WP_000889093.1.45691 WP_000889093.1.45746 WP_000889093.1.45749 WP_000889093.1.45753 WP_000889093.1.45762 WP_000889093.1.45810 WP_000889093.1.45820 WP_000889093.1.45825 WP_000889093.1.45843 WP_000889093.1.45879 WP_000889093.1.45886 WP_000889093.1.45917 WP_000889093.1.45927 WP_000889093.1.45948 WP_000889093.1.45959 WP_000889093.1.45981 WP_000889093.1.45993 WP_000889093.1.46012 WP_000889093.1.46022 WP_000889093.1.46024 WP_000889093.1.46044 WP_000889093.1.46060 WP_000889093.1.46074 WP_000889093.1.46084 WP_000889093.1.46088 WP_000889093.1.46089 WP_000889093.1.46094 WP_000889093.1.46149 WP_000889093.1.46166 WP_000889093.1.46177 WP_000889093.1.46178 WP_000889093.1.46191 WP_000889093.1.46206 WP_000889093.1.4621 WP_000889093.1.46251 WP_000889093.1.46252 WP_000889093.1.46270 WP_000889093.1.46281 WP_000889093.1.46284 WP_000889093.1.4629 WP_000889093.1.46295 WP_000889093.1.46296 WP_000889093.1.46315 WP_000889093.1.46470 WP_000889093.1.46480 WP_000889093.1.46483 WP_000889093.1.46498 WP_000889093.1.46500 WP_000889093.1.46501 WP_000889093.1.4656 WP_000889093.1.46560 WP_000889093.1.46562 WP_000889093.1.46564 WP_000889093.1.46565 WP_000889093.1.46571 WP_000889093.1.4659 WP_000889093.1.46598 WP_000889093.1.46610 WP_000889093.1.46632 WP_000889093.1.46634 WP_000889093.1.46656 WP_000889093.1.4667 WP_000889093.1.46673 WP_000889093.1.46683 WP_000889093.1.46687 WP_000889093.1.46694 WP_000889093.1.46695 WP_000889093.1.46709 WP_000889093.1.46716 WP_000889093.1.46783 WP_000889093.1.46784 WP_000889093.1.46789 WP_000889093.1.46809 WP_000889093.1.46822 WP_000889093.1.46831 WP_000889093.1.46835 WP_000889093.1.46854 WP_000889093.1.46858 WP_000889093.1.46871 WP_000889093.1.46874 WP_000889093.1.46878 WP_000889093.1.46884 WP_000889093.1.46892 WP_000889093.1.469 WP_000889093.1.46901 WP_000889093.1.46915 WP_000889093.1.46919 WP_000889093.1.46923 WP_000889093.1.46927 WP_000889093.1.46934 WP_000889093.1.46955 WP_000889093.1.46966 WP_000889093.1.47004 WP_000889093.1.47017 WP_000889093.1.47033 WP_000889093.1.47043 WP_000889093.1.47045 WP_000889093.1.47056 WP_000889093.1.4707 WP_000889093.1.47076 WP_000889093.1.47096 WP_000889093.1.47103 WP_000889093.1.47114 WP_000889093.1.47168 WP_000889093.1.47176 WP_000889093.1.47180 WP_000889093.1.47183 WP_000889093.1.47213 WP_000889093.1.47272 WP_000889093.1.47288 WP_000889093.1.47327 WP_000889093.1.47338 WP_000889093.1.47342 WP_000889093.1.47365 WP_000889093.1.47394 WP_000889093.1.47395 WP_000889093.1.47409 WP_000889093.1.47415 WP_000889093.1.47420 WP_000889093.1.47444 WP_000889093.1.47452 WP_000889093.1.47462 WP_000889093.1.47466 WP_000889093.1.47489 WP_000889093.1.47490 WP_000889093.1.47508 WP_000889093.1.47513 WP_000889093.1.47569 WP_000889093.1.47595 WP_000889093.1.47596 WP_000889093.1.47620 WP_000889093.1.47633 WP_000889093.1.47635 WP_000889093.1.47651 WP_000889093.1.47657 WP_000889093.1.4768 WP_000889093.1.47699 WP_000889093.1.47766 WP_000889093.1.47771 WP_000889093.1.47785 WP_000889093.1.478 WP_000889093.1.47819 WP_000889093.1.47824 WP_000889093.1.47833 WP_000889093.1.47853 WP_000889093.1.47860 WP_000889093.1.4789 WP_000889093.1.47890 WP_000889093.1.4790 WP_000889093.1.47905 WP_000889093.1.47923 WP_000889093.1.47973 WP_000889093.1.47977 WP_000889093.1.4798 WP_000889093.1.47987 WP_000889093.1.48015 WP_000889093.1.48031 WP_000889093.1.48037 WP_000889093.1.4804 WP_000889093.1.48043 WP_000889093.1.48060 WP_000889093.1.48089 WP_000889093.1.48112 WP_000889093.1.48122 WP_000889093.1.48137 WP_000889093.1.48148 WP_000889093.1.48171 WP_000889093.1.48181 WP_000889093.1.4822 WP_000889093.1.48232 WP_000889093.1.48257 WP_000889093.1.48296 WP_000889093.1.48309 WP_000889093.1.48349 WP_000889093.1.48384 WP_000889093.1.48387 WP_000889093.1.48395 WP_000889093.1.48420 WP_000889093.1.48422 WP_000889093.1.48447 WP_000889093.1.48468 WP_000889093.1.48481 WP_000889093.1.48489 WP_000889093.1.48498 WP_000889093.1.48503 WP_000889093.1.48511 WP_000889093.1.48520 WP_000889093.1.48533 WP_000889093.1.48537 WP_000889093.1.48582 WP_000889093.1.48589 WP_000889093.1.48595 WP_000889093.1.48604 WP_000889093.1.48614 WP_000889093.1.48619 WP_000889093.1.48625 WP_000889093.1.48669 WP_000889093.1.48698 WP_000889093.1.48718 WP_000889093.1.48730 WP_000889093.1.48731 WP_000889093.1.48739 WP_000889093.1.48753 WP_000889093.1.48758 WP_000889093.1.48767 WP_000889093.1.48780 WP_000889093.1.48796 WP_000889093.1.48799 WP_000889093.1.48800 WP_000889093.1.48804 WP_000889093.1.4882 WP_000889093.1.48828 WP_000889093.1.48890 WP_000889093.1.48892 WP_000889093.1.48922 WP_000889093.1.4894 WP_000889093.1.4895 WP_000889093.1.48964 WP_000889093.1.48986 WP_000889093.1.48998 WP_000889093.1.490 WP_000889093.1.49000 WP_000889093.1.49008 WP_000889093.1.49021 WP_000889093.1.49025 WP_000889093.1.49033 WP_000889093.1.49038 WP_000889093.1.49050 WP_000889093.1.49060 WP_000889093.1.49062 WP_000889093.1.49066 WP_000889093.1.49074 WP_000889093.1.49075 WP_000889093.1.49115 WP_000889093.1.49118 WP_000889093.1.49122 WP_000889093.1.49130 WP_000889093.1.49134 WP_000889093.1.49181 WP_000889093.1.492 WP_000889093.1.49216 WP_000889093.1.49232 WP_000889093.1.49268 WP_000889093.1.49283 WP_000889093.1.49303 WP_000889093.1.4933 WP_000889093.1.49331 WP_000889093.1.4934 WP_000889093.1.49354 WP_000889093.1.49385 WP_000889093.1.49389 WP_000889093.1.49407 WP_000889093.1.49408 WP_000889093.1.4951 WP_000889093.1.49510 WP_000889093.1.49514 WP_000889093.1.49538 WP_000889093.1.49540 WP_000889093.1.4957 WP_000889093.1.49571 WP_000889093.1.49587 WP_000889093.1.49597 WP_000889093.1.4960 WP_000889093.1.49600 WP_000889093.1.49601 WP_000889093.1.49627 WP_000889093.1.49628 WP_000889093.1.49635 WP_000889093.1.49636 WP_000889093.1.49752 WP_000889093.1.49759 WP_000889093.1.49765 WP_000889093.1.49776 WP_000889093.1.49785 WP_000889093.1.49801 WP_000889093.1.49840 WP_000889093.1.49841 WP_000889093.1.49845 WP_000889093.1.49873 WP_000889093.1.49874 WP_000889093.1.49889 WP_000889093.1.49904 WP_000889093.1.49909 WP_000889093.1.4996 WP_000889093.1.49964 WP_000889093.1.49971 WP_000889093.1.49973 WP_000889093.1.49975 WP_000889093.1.50000 WP_000889093.1.50001 WP_000889093.1.50005 WP_000889093.1.50016 WP_000889093.1.50031 WP_000889093.1.50034 WP_000889093.1.50048 WP_000889093.1.50070 WP_000889093.1.50089 WP_000889093.1.50105 WP_000889093.1.50107 WP_000889093.1.50108 WP_000889093.1.50120 WP_000889093.1.50129 WP_000889093.1.50134 WP_000889093.1.50139 WP_000889093.1.50143 WP_000889093.1.5015 WP_000889093.1.50151 WP_000889093.1.50168 WP_000889093.1.50169 WP_000889093.1.50200 WP_000889093.1.50209 WP_000889093.1.5022 WP_000889093.1.5024 WP_000889093.1.50244 WP_000889093.1.50246 WP_000889093.1.50259 WP_000889093.1.50263 WP_000889093.1.50275 WP_000889093.1.50281 WP_000889093.1.50305 WP_000889093.1.50315 WP_000889093.1.50318 WP_000889093.1.50327 WP_000889093.1.50383 WP_000889093.1.50396 WP_000889093.1.50422 WP_000889093.1.50436 WP_000889093.1.50442 WP_000889093.1.50467 WP_000889093.1.50474 WP_000889093.1.50489 WP_000889093.1.5049 WP_000889093.1.50492 WP_000889093.1.50501 WP_000889093.1.50526 WP_000889093.1.50530 WP_000889093.1.50560 WP_000889093.1.50572 WP_000889093.1.50580 WP_000889093.1.5060 WP_000889093.1.50603 WP_000889093.1.50604 WP_000889093.1.50613 WP_000889093.1.50615 WP_000889093.1.50621 WP_000889093.1.50628 WP_000889093.1.50637 WP_000889093.1.50649 WP_000889093.1.5065 WP_000889093.1.50657 WP_000889093.1.50664 WP_000889093.1.50685 WP_000889093.1.507 WP_000889093.1.50709 WP_000889093.1.50743 WP_000889093.1.50757 WP_000889093.1.50764 WP_000889093.1.50785 WP_000889093.1.50797 WP_000889093.1.50821 WP_000889093.1.50824 WP_000889093.1.50835 WP_000889093.1.50838 WP_000889093.1.50843 WP_000889093.1.50846 WP_000889093.1.50849 WP_000889093.1.50870 WP_000889093.1.50915 WP_000889093.1.50930 WP_000889093.1.50948 WP_000889093.1.50965 WP_000889093.1.50978 WP_000889093.1.50995 WP_000889093.1.51032 WP_000889093.1.51041 WP_000889093.1.51054 WP_000889093.1.51080 WP_000889093.1.51083 WP_000889093.1.51089 WP_000889093.1.51096 WP_000889093.1.51098 WP_000889093.1.51110 WP_000889093.1.51113 WP_000889093.1.5112 WP_000889093.1.51143 WP_000889093.1.5116 WP_000889093.1.51188 WP_000889093.1.51205 WP_000889093.1.51210 WP_000889093.1.51218 WP_000889093.1.51237 WP_000889093.1.51238 WP_000889093.1.51243 WP_000889093.1.51249 WP_000889093.1.51316 WP_000889093.1.5134 WP_000889093.1.51361 WP_000889093.1.51379 WP_000889093.1.51383 WP_000889093.1.51417 WP_000889093.1.51420 WP_000889093.1.51439 WP_000889093.1.51444 WP_000889093.1.51449 WP_000889093.1.51467 WP_000889093.1.51470 WP_000889093.1.51475 WP_000889093.1.51476 WP_000889093.1.51504 WP_000889093.1.51507 WP_000889093.1.51511 WP_000889093.1.51528 WP_000889093.1.51533 WP_000889093.1.51541 WP_000889093.1.51546 WP_000889093.1.51554 WP_000889093.1.51562 WP_000889093.1.51579 WP_000889093.1.51602 WP_000889093.1.51626 WP_000889093.1.51658 WP_000889093.1.5166 WP_000889093.1.51673 WP_000889093.1.51684 WP_000889093.1.5169 WP_000889093.1.51714 WP_000889093.1.51715 WP_000889093.1.51726 WP_000889093.1.51742 WP_000889093.1.51750 WP_000889093.1.51762 WP_000889093.1.51776 WP_000889093.1.51777 WP_000889093.1.51806 WP_000889093.1.51809 WP_000889093.1.51820 WP_000889093.1.51825 WP_000889093.1.51826 WP_000889093.1.51830 WP_000889093.1.51835 WP_000889093.1.51855 WP_000889093.1.5188 WP_000889093.1.51893 WP_000889093.1.5191 WP_000889093.1.51947 WP_000889093.1.5196 WP_000889093.1.51960 WP_000889093.1.51962 WP_000889093.1.5198 WP_000889093.1.51983 WP_000889093.1.52004 WP_000889093.1.52007 WP_000889093.1.52014 WP_000889093.1.52018 WP_000889093.1.52026 WP_000889093.1.52028 WP_000889093.1.5204 WP_000889093.1.52042 WP_000889093.1.52049 WP_000889093.1.52055 WP_000889093.1.52060 WP_000889093.1.52064 WP_000889093.1.52107 WP_000889093.1.52108 WP_000889093.1.52116 WP_000889093.1.5212 WP_000889093.1.52143 WP_000889093.1.52155 WP_000889093.1.52157 WP_000889093.1.52228 WP_000889093.1.52231 WP_000889093.1.52263 WP_000889093.1.52276 WP_000889093.1.52315 WP_000889093.1.52317 WP_000889093.1.52319 WP_000889093.1.52323 WP_000889093.1.52329 WP_000889093.1.52373 WP_000889093.1.52384 WP_000889093.1.52386 WP_000889093.1.5242 WP_000889093.1.5244 WP_000889093.1.52443 WP_000889093.1.52453 WP_000889093.1.52512 WP_000889093.1.52540 WP_000889093.1.52551 WP_000889093.1.52570 WP_000889093.1.52581 WP_000889093.1.52597 WP_000889093.1.52600 WP_000889093.1.5261 WP_000889093.1.52709 WP_000889093.1.52721 WP_000889093.1.52759 WP_000889093.1.52770 WP_000889093.1.52783 WP_000889093.1.52788 WP_000889093.1.52825 WP_000889093.1.52834 WP_000889093.1.52842 WP_000889093.1.52843 WP_000889093.1.52854 WP_000889093.1.52856 WP_000889093.1.52879 WP_000889093.1.52896 WP_000889093.1.52921 WP_000889093.1.52923 WP_000889093.1.52940 WP_000889093.1.52957 WP_000889093.1.52972 WP_000889093.1.52975 WP_000889093.1.52977 WP_000889093.1.52978 WP_000889093.1.5298 WP_000889093.1.52987 WP_000889093.1.52988 WP_000889093.1.53010 WP_000889093.1.53039 WP_000889093.1.53042 WP_000889093.1.53054 WP_000889093.1.53068 WP_000889093.1.53079 WP_000889093.1.53096 WP_000889093.1.53108 WP_000889093.1.53112 WP_000889093.1.53129 WP_000889093.1.53149 WP_000889093.1.53166 WP_000889093.1.53183 WP_000889093.1.53205 WP_000889093.1.53212 WP_000889093.1.53235 WP_000889093.1.53239 WP_000889093.1.53241 WP_000889093.1.53243 WP_000889093.1.53249 WP_000889093.1.53268 WP_000889093.1.53275 WP_000889093.1.53295 WP_000889093.1.53297 WP_000889093.1.53320 WP_000889093.1.53337 WP_000889093.1.53339 WP_000889093.1.53340 WP_000889093.1.53355 WP_000889093.1.53357 WP_000889093.1.53365 WP_000889093.1.53395 WP_000889093.1.53404 WP_000889093.1.53405 WP_000889093.1.53420 WP_000889093.1.53429 WP_000889093.1.53430 WP_000889093.1.53440 WP_000889093.1.53476 WP_000889093.1.5348 WP_000889093.1.53499 WP_000889093.1.53524 WP_000889093.1.53581 WP_000889093.1.53596 WP_000889093.1.53600 WP_000889093.1.5361 WP_000889093.1.53612 WP_000889093.1.53633 WP_000889093.1.5364 WP_000889093.1.53640 WP_000889093.1.53652 WP_000889093.1.53660 WP_000889093.1.53673 WP_000889093.1.53677 WP_000889093.1.53684 WP_000889093.1.53697 WP_000889093.1.53699 WP_000889093.1.53735 WP_000889093.1.53744 WP_000889093.1.53756 WP_000889093.1.53761 WP_000889093.1.5377 WP_000889093.1.53773 WP_000889093.1.53789 WP_000889093.1.53798 WP_000889093.1.53820 WP_000889093.1.5385 WP_000889093.1.53871 WP_000889093.1.53891 WP_000889093.1.53929 WP_000889093.1.53950 WP_000889093.1.5396 WP_000889093.1.54001 WP_000889093.1.54021 WP_000889093.1.54027 WP_000889093.1.5405 WP_000889093.1.54050 WP_000889093.1.54064 WP_000889093.1.54065 WP_000889093.1.54066 WP_000889093.1.54069 WP_000889093.1.5411 WP_000889093.1.54110 WP_000889093.1.54130 WP_000889093.1.54163 WP_000889093.1.5418 WP_000889093.1.54183 WP_000889093.1.54187 WP_000889093.1.54214 WP_000889093.1.54221 WP_000889093.1.54231 WP_000889093.1.5424 WP_000889093.1.543 WP_000889093.1.54303 WP_000889093.1.5431 WP_000889093.1.5432 WP_000889093.1.54334 WP_000889093.1.54337 WP_000889093.1.54345 WP_000889093.1.54349 WP_000889093.1.5435 WP_000889093.1.54372 WP_000889093.1.54374 WP_000889093.1.54376 WP_000889093.1.54401 WP_000889093.1.54402 WP_000889093.1.54412 WP_000889093.1.5442 WP_000889093.1.54424 WP_000889093.1.54433 WP_000889093.1.54457 WP_000889093.1.54458 WP_000889093.1.54473 WP_000889093.1.54475 WP_000889093.1.54483 WP_000889093.1.54501 WP_000889093.1.54515 WP_000889093.1.54529 WP_000889093.1.5453 WP_000889093.1.54549 WP_000889093.1.54559 WP_000889093.1.54563 WP_000889093.1.54570 WP_000889093.1.54576 WP_000889093.1.54597 WP_000889093.1.54631 WP_000889093.1.54658 WP_000889093.1.54680 WP_000889093.1.54697 WP_000889093.1.54738 WP_000889093.1.54762 WP_000889093.1.5477 WP_000889093.1.54792 WP_000889093.1.54793 WP_000889093.1.54796 WP_000889093.1.54805 WP_000889093.1.54810 WP_000889093.1.54813 WP_000889093.1.54840 WP_000889093.1.54848 WP_000889093.1.54872 WP_000889093.1.54894 WP_000889093.1.54907 WP_000889093.1.54922 WP_000889093.1.54932 WP_000889093.1.5495 WP_000889093.1.54960 WP_000889093.1.54971 WP_000889093.1.54997 WP_000889093.1.55035 WP_000889093.1.55039 WP_000889093.1.5504 WP_000889093.1.55053 WP_000889093.1.55066 WP_000889093.1.55071 WP_000889093.1.55079 WP_000889093.1.55087 WP_000889093.1.55091 WP_000889093.1.55093 WP_000889093.1.55107 WP_000889093.1.55120 WP_000889093.1.55143 WP_000889093.1.55148 WP_000889093.1.55154 WP_000889093.1.55207 WP_000889093.1.55211 WP_000889093.1.55217 WP_000889093.1.55244 WP_000889093.1.55277 WP_000889093.1.55281 WP_000889093.1.55292 WP_000889093.1.55299 WP_000889093.1.55312 WP_000889093.1.55314 WP_000889093.1.55329 WP_000889093.1.55331 WP_000889093.1.55332 WP_000889093.1.55337 WP_000889093.1.55360 WP_000889093.1.55362 WP_000889093.1.55377 WP_000889093.1.55395 WP_000889093.1.55411 WP_000889093.1.55432 WP_000889093.1.55438 WP_000889093.1.55474 WP_000889093.1.55479 WP_000889093.1.55499 WP_000889093.1.55519 WP_000889093.1.55523 WP_000889093.1.55524 WP_000889093.1.55525 WP_000889093.1.55531 WP_000889093.1.55532 WP_000889093.1.55534 WP_000889093.1.55561 WP_000889093.1.55566 WP_000889093.1.55587 WP_000889093.1.55589 WP_000889093.1.55594 WP_000889093.1.55605 WP_000889093.1.55654 WP_000889093.1.55677 WP_000889093.1.55685 WP_000889093.1.55708 WP_000889093.1.55711 WP_000889093.1.55716 WP_000889093.1.55722 WP_000889093.1.55726 WP_000889093.1.55733 WP_000889093.1.55761 WP_000889093.1.55763 WP_000889093.1.5578 WP_000889093.1.55810 WP_000889093.1.55816 WP_000889093.1.55836 WP_000889093.1.55861 WP_000889093.1.5588 WP_000889093.1.55881 WP_000889093.1.55889 WP_000889093.1.55906 WP_000889093.1.55918 WP_000889093.1.55947 WP_000889093.1.55969 WP_000889093.1.55978 WP_000889093.1.55980 WP_000889093.1.5599 WP_000889093.1.560 WP_000889093.1.56022 WP_000889093.1.56041 WP_000889093.1.56054 WP_000889093.1.56062 WP_000889093.1.56112 WP_000889093.1.56124 WP_000889093.1.56136 WP_000889093.1.56155 WP_000889093.1.56185 WP_000889093.1.56251 WP_000889093.1.56257 WP_000889093.1.56276 WP_000889093.1.56283 WP_000889093.1.56294 WP_000889093.1.56300 WP_000889093.1.56319 WP_000889093.1.56326 WP_000889093.1.56378 WP_000889093.1.56382 WP_000889093.1.56408 WP_000889093.1.56461 WP_000889093.1.56462 WP_000889093.1.56466 WP_000889093.1.56472 WP_000889093.1.56476 WP_000889093.1.56477 WP_000889093.1.56515 WP_000889093.1.56518 WP_000889093.1.56519 WP_000889093.1.5652 WP_000889093.1.56546 WP_000889093.1.56581 WP_000889093.1.56582 WP_000889093.1.56605 WP_000889093.1.56607 WP_000889093.1.56617 WP_000889093.1.56622 WP_000889093.1.56624 WP_000889093.1.5663 WP_000889093.1.56653 WP_000889093.1.56657 WP_000889093.1.56676 WP_000889093.1.56678 WP_000889093.1.5673 WP_000889093.1.56734 WP_000889093.1.56739 WP_000889093.1.56746 WP_000889093.1.56749 WP_000889093.1.56756 WP_000889093.1.56771 WP_000889093.1.56774 WP_000889093.1.56775 WP_000889093.1.56790 WP_000889093.1.56805 WP_000889093.1.56881 WP_000889093.1.56884 WP_000889093.1.5689 WP_000889093.1.56902 WP_000889093.1.56913 WP_000889093.1.56940 WP_000889093.1.56989 WP_000889093.1.56995 WP_000889093.1.56999 WP_000889093.1.57001 WP_000889093.1.57004 WP_000889093.1.57009 WP_000889093.1.57013 WP_000889093.1.57017 WP_000889093.1.57037 WP_000889093.1.57040 WP_000889093.1.57044 WP_000889093.1.5708 WP_000889093.1.57089 WP_000889093.1.5709 WP_000889093.1.5710 WP_000889093.1.57118 WP_000889093.1.57119 WP_000889093.1.57176 WP_000889093.1.57192 WP_000889093.1.57194 WP_000889093.1.57218 WP_000889093.1.57219 WP_000889093.1.57235 WP_000889093.1.57274 WP_000889093.1.57292 WP_000889093.1.57303 WP_000889093.1.57321 WP_000889093.1.57334 WP_000889093.1.57382 WP_000889093.1.57384 WP_000889093.1.57394 WP_000889093.1.5741 WP_000889093.1.57419 WP_000889093.1.57428 WP_000889093.1.57442 WP_000889093.1.57446 WP_000889093.1.57472 WP_000889093.1.57490 WP_000889093.1.57516 WP_000889093.1.57530 WP_000889093.1.57554 WP_000889093.1.57587 WP_000889093.1.57611 WP_000889093.1.57615 WP_000889093.1.57620 WP_000889093.1.57668 WP_000889093.1.57677 WP_000889093.1.57687 WP_000889093.1.57698 WP_000889093.1.57712 WP_000889093.1.57725 WP_000889093.1.57726 WP_000889093.1.57743 WP_000889093.1.57753 WP_000889093.1.57777 WP_000889093.1.57787 WP_000889093.1.57789 WP_000889093.1.5779 WP_000889093.1.578 WP_000889093.1.57816 WP_000889093.1.57866 WP_000889093.1.57876 WP_000889093.1.57882 WP_000889093.1.57896 WP_000889093.1.57897 WP_000889093.1.57917 WP_000889093.1.57922 WP_000889093.1.5793 WP_000889093.1.5800 WP_000889093.1.58013 WP_000889093.1.58021 WP_000889093.1.58027 WP_000889093.1.58032 WP_000889093.1.58034 WP_000889093.1.58036 WP_000889093.1.58039 WP_000889093.1.58070 WP_000889093.1.58076 WP_000889093.1.58095 WP_000889093.1.58124 WP_000889093.1.5813 WP_000889093.1.58156 WP_000889093.1.58166 WP_000889093.1.58171 WP_000889093.1.58181 WP_000889093.1.58189 WP_000889093.1.5819 WP_000889093.1.58196 WP_000889093.1.58211 WP_000889093.1.58217 WP_000889093.1.58225 WP_000889093.1.58227 WP_000889093.1.58243 WP_000889093.1.58264 WP_000889093.1.58268 WP_000889093.1.58296 WP_000889093.1.58322 WP_000889093.1.58331 WP_000889093.1.58344 WP_000889093.1.58348 WP_000889093.1.5835 WP_000889093.1.58378 WP_000889093.1.58402 WP_000889093.1.58404 WP_000889093.1.58434 WP_000889093.1.58437 WP_000889093.1.58452 WP_000889093.1.58458 WP_000889093.1.58474 WP_000889093.1.58492 WP_000889093.1.58522 WP_000889093.1.58553 WP_000889093.1.58554 WP_000889093.1.58563 WP_000889093.1.58574 WP_000889093.1.58591 WP_000889093.1.58595 WP_000889093.1.58607 WP_000889093.1.58613 WP_000889093.1.58615 WP_000889093.1.58627 WP_000889093.1.58642 WP_000889093.1.58645 WP_000889093.1.58646 WP_000889093.1.58653 WP_000889093.1.58679 WP_000889093.1.58697 WP_000889093.1.58700 WP_000889093.1.58717 WP_000889093.1.58761 WP_000889093.1.58762 WP_000889093.1.58778 WP_000889093.1.58811 WP_000889093.1.58827 WP_000889093.1.58829 WP_000889093.1.58841 WP_000889093.1.58843 WP_000889093.1.58849 WP_000889093.1.58854 WP_000889093.1.58877 WP_000889093.1.58905 WP_000889093.1.58948 WP_000889093.1.58959 WP_000889093.1.59001 WP_000889093.1.59007 WP_000889093.1.59028 WP_000889093.1.59033 WP_000889093.1.59065 WP_000889093.1.59066 WP_000889093.1.59109 WP_000889093.1.59117 WP_000889093.1.59137 WP_000889093.1.5916 WP_000889093.1.59160 WP_000889093.1.59198 WP_000889093.1.59201 WP_000889093.1.59208 WP_000889093.1.5921 WP_000889093.1.59229 WP_000889093.1.59235 WP_000889093.1.59242 WP_000889093.1.59257 WP_000889093.1.59268 WP_000889093.1.59307 WP_000889093.1.59308 WP_000889093.1.5934 WP_000889093.1.59356 WP_000889093.1.59361 WP_000889093.1.59367 WP_000889093.1.59370 WP_000889093.1.5939 WP_000889093.1.5941 WP_000889093.1.59424 WP_000889093.1.59442 WP_000889093.1.59468 WP_000889093.1.59482 WP_000889093.1.59527 WP_000889093.1.59532 WP_000889093.1.59534 WP_000889093.1.59552 WP_000889093.1.59558 WP_000889093.1.59583 WP_000889093.1.59589 WP_000889093.1.59595 WP_000889093.1.59607 WP_000889093.1.59608 WP_000889093.1.59637 WP_000889093.1.59642 WP_000889093.1.59666 WP_000889093.1.59673 WP_000889093.1.59676 WP_000889093.1.59678 WP_000889093.1.59718 WP_000889093.1.59721 WP_000889093.1.59740 WP_000889093.1.5976 WP_000889093.1.59774 WP_000889093.1.59785 WP_000889093.1.59814 WP_000889093.1.59883 WP_000889093.1.59884 WP_000889093.1.59895 WP_000889093.1.59906 WP_000889093.1.59913 WP_000889093.1.59918 WP_000889093.1.59938 WP_000889093.1.59951 WP_000889093.1.6001 WP_000889093.1.60026 WP_000889093.1.60032 WP_000889093.1.60064 WP_000889093.1.60073 WP_000889093.1.60078 WP_000889093.1.60105 WP_000889093.1.60174 WP_000889093.1.60177 WP_000889093.1.60180 WP_000889093.1.60210 WP_000889093.1.60242 WP_000889093.1.60248 WP_000889093.1.60256 WP_000889093.1.60281 WP_000889093.1.60298 WP_000889093.1.60309 WP_000889093.1.60326 WP_000889093.1.60384 WP_000889093.1.60385 WP_000889093.1.60388 WP_000889093.1.60391 WP_000889093.1.60423 WP_000889093.1.60450 WP_000889093.1.60485 WP_000889093.1.60513 WP_000889093.1.60529 WP_000889093.1.60532 WP_000889093.1.60541 WP_000889093.1.60574 WP_000889093.1.60590 WP_000889093.1.60592 WP_000889093.1.60601 WP_000889093.1.60615 WP_000889093.1.60621 WP_000889093.1.6063 WP_000889093.1.60637 WP_000889093.1.60642 WP_000889093.1.60656 WP_000889093.1.60670 WP_000889093.1.60693 WP_000889093.1.60714 WP_000889093.1.60731 WP_000889093.1.60737 WP_000889093.1.60749 WP_000889093.1.60755 WP_000889093.1.6079 WP_000889093.1.60799 WP_000889093.1.6081 WP_000889093.1.60815 WP_000889093.1.60867 WP_000889093.1.6087 WP_000889093.1.60886 WP_000889093.1.6091 WP_000889093.1.60911 WP_000889093.1.6092 WP_000889093.1.60924 WP_000889093.1.60961 WP_000889093.1.60977 WP_000889093.1.60985 WP_000889093.1.60993 WP_000889093.1.60996 WP_000889093.1.61021 WP_000889093.1.61028 WP_000889093.1.61043 WP_000889093.1.61050 WP_000889093.1.61088 WP_000889093.1.61151 WP_000889093.1.61159 WP_000889093.1.61164 WP_000889093.1.61182 WP_000889093.1.61194 WP_000889093.1.61208 WP_000889093.1.61214 WP_000889093.1.61220 WP_000889093.1.61226 WP_000889093.1.61236 WP_000889093.1.61250 WP_000889093.1.61254 WP_000889093.1.61278 WP_000889093.1.6128 WP_000889093.1.61300 WP_000889093.1.61301 WP_000889093.1.61302 WP_000889093.1.61307 WP_000889093.1.61348 WP_000889093.1.61363 WP_000889093.1.61365 WP_000889093.1.6137 WP_000889093.1.61372 WP_000889093.1.61378 WP_000889093.1.61386 WP_000889093.1.61396 WP_000889093.1.6140 WP_000889093.1.61404 WP_000889093.1.61405 WP_000889093.1.61423 WP_000889093.1.61444 WP_000889093.1.61451 WP_000889093.1.61460 WP_000889093.1.61471 WP_000889093.1.61489 WP_000889093.1.61495 WP_000889093.1.61499 WP_000889093.1.61506 WP_000889093.1.61513 WP_000889093.1.61514 WP_000889093.1.61531 WP_000889093.1.61541 WP_000889093.1.61548 WP_000889093.1.61550 WP_000889093.1.61560 WP_000889093.1.61605 WP_000889093.1.61606 WP_000889093.1.61627 WP_000889093.1.61632 WP_000889093.1.61651 WP_000889093.1.61675 WP_000889093.1.61686 WP_000889093.1.61700 WP_000889093.1.61731 WP_000889093.1.61733 WP_000889093.1.61735 WP_000889093.1.6174 WP_000889093.1.61751 WP_000889093.1.61765 WP_000889093.1.61785 WP_000889093.1.61807 WP_000889093.1.61837 WP_000889093.1.61845 WP_000889093.1.61848 WP_000889093.1.61863 WP_000889093.1.61882 WP_000889093.1.61896 WP_000889093.1.61912 WP_000889093.1.61916 WP_000889093.1.61959 WP_000889093.1.62001 WP_000889093.1.62006 WP_000889093.1.62039 WP_000889093.1.62062 WP_000889093.1.6207 WP_000889093.1.62118 WP_000889093.1.62129 WP_000889093.1.62134 WP_000889093.1.62137 WP_000889093.1.62145 WP_000889093.1.62151 WP_000889093.1.62161 WP_000889093.1.62173 WP_000889093.1.62178 WP_000889093.1.62190 WP_000889093.1.62197 WP_000889093.1.62216 WP_000889093.1.62220 WP_000889093.1.62235 WP_000889093.1.6226 WP_000889093.1.62283 WP_000889093.1.62287 WP_000889093.1.62293 WP_000889093.1.62315 WP_000889093.1.62316 WP_000889093.1.6235 WP_000889093.1.62356 WP_000889093.1.62366 WP_000889093.1.62390 WP_000889093.1.62394 WP_000889093.1.62397 WP_000889093.1.62417 WP_000889093.1.62421 WP_000889093.1.62432 WP_000889093.1.62434 WP_000889093.1.6244 WP_000889093.1.62444 WP_000889093.1.62445 WP_000889093.1.62465 WP_000889093.1.62518 WP_000889093.1.62521 WP_000889093.1.62524 WP_000889093.1.62532 WP_000889093.1.62540 WP_000889093.1.62546 WP_000889093.1.62559 WP_000889093.1.6258 WP_000889093.1.62581 WP_000889093.1.62583 WP_000889093.1.62600 WP_000889093.1.62607 WP_000889093.1.62613 WP_000889093.1.62615 WP_000889093.1.62638 WP_000889093.1.62643 WP_000889093.1.62667 WP_000889093.1.62775 WP_000889093.1.62777 WP_000889093.1.62779 WP_000889093.1.6279 WP_000889093.1.62799 WP_000889093.1.62803 WP_000889093.1.62821 WP_000889093.1.62833 WP_000889093.1.62836 WP_000889093.1.62862 WP_000889093.1.62867 WP_000889093.1.6288 WP_000889093.1.62899 WP_000889093.1.62921 WP_000889093.1.62944 WP_000889093.1.62969 WP_000889093.1.62987 WP_000889093.1.62994 WP_000889093.1.63029 WP_000889093.1.63033 WP_000889093.1.63034 WP_000889093.1.6306 WP_000889093.1.63067 WP_000889093.1.63075 WP_000889093.1.63077 WP_000889093.1.6309 WP_000889093.1.63093 WP_000889093.1.63125 WP_000889093.1.63128 WP_000889093.1.63149 WP_000889093.1.63156 WP_000889093.1.6316 WP_000889093.1.63165 WP_000889093.1.63191 WP_000889093.1.63214 WP_000889093.1.63225 WP_000889093.1.63230 WP_000889093.1.63235 WP_000889093.1.63238 WP_000889093.1.63245 WP_000889093.1.63311 WP_000889093.1.63328 WP_000889093.1.63329 WP_000889093.1.6341 WP_000889093.1.63425 WP_000889093.1.63430 WP_000889093.1.63431 WP_000889093.1.63442 WP_000889093.1.63468 WP_000889093.1.63473 WP_000889093.1.63503 WP_000889093.1.63506 WP_000889093.1.63543 WP_000889093.1.63544 WP_000889093.1.63587 WP_000889093.1.63621 WP_000889093.1.63724 WP_000889093.1.63741 WP_000889093.1.63753 WP_000889093.1.63762 WP_000889093.1.63778 WP_000889093.1.63787 WP_000889093.1.63792 WP_000889093.1.6382 WP_000889093.1.63846 WP_000889093.1.63859 WP_000889093.1.63882 WP_000889093.1.63893 WP_000889093.1.63908 WP_000889093.1.63919 WP_000889093.1.63920 WP_000889093.1.6393 WP_000889093.1.63931 WP_000889093.1.63935 WP_000889093.1.63936 WP_000889093.1.63938 WP_000889093.1.63943 WP_000889093.1.63971 WP_000889093.1.63988 WP_000889093.1.64002 WP_000889093.1.64006 WP_000889093.1.6405 WP_000889093.1.64055 WP_000889093.1.64067 WP_000889093.1.6410 WP_000889093.1.64113 WP_000889093.1.64126 WP_000889093.1.64135 WP_000889093.1.6414 WP_000889093.1.64163 WP_000889093.1.64167 WP_000889093.1.64172 WP_000889093.1.64184 WP_000889093.1.64203 WP_000889093.1.64225 WP_000889093.1.64245 WP_000889093.1.64246 WP_000889093.1.64267 WP_000889093.1.64316 WP_000889093.1.64320 WP_000889093.1.64322 WP_000889093.1.64338 WP_000889093.1.64342 WP_000889093.1.64359 WP_000889093.1.64373 WP_000889093.1.64399 WP_000889093.1.64401 WP_000889093.1.64416 WP_000889093.1.64423 WP_000889093.1.64449 WP_000889093.1.64464 WP_000889093.1.6447 WP_000889093.1.64481 WP_000889093.1.64490 WP_000889093.1.64496 WP_000889093.1.64518 WP_000889093.1.64653 WP_000889093.1.6467 WP_000889093.1.64679 WP_000889093.1.64696 WP_000889093.1.64698 WP_000889093.1.6470 WP_000889093.1.64700 WP_000889093.1.64719 WP_000889093.1.64723 WP_000889093.1.64725 WP_000889093.1.64728 WP_000889093.1.64733 WP_000889093.1.64734 WP_000889093.1.64739 WP_000889093.1.6474 WP_000889093.1.64750 WP_000889093.1.64756 WP_000889093.1.64778 WP_000889093.1.6478 WP_000889093.1.64782 WP_000889093.1.64785 WP_000889093.1.64815 WP_000889093.1.64816 WP_000889093.1.64824 WP_000889093.1.64837 WP_000889093.1.64839 WP_000889093.1.6485 WP_000889093.1.64851 WP_000889093.1.64855 WP_000889093.1.64857 WP_000889093.1.64867 WP_000889093.1.64871 WP_000889093.1.64876 WP_000889093.1.64882 WP_000889093.1.64890 WP_000889093.1.649 WP_000889093.1.64906 WP_000889093.1.6491 WP_000889093.1.64913 WP_000889093.1.64917 WP_000889093.1.64931 WP_000889093.1.6495 WP_000889093.1.64960 WP_000889093.1.64993 WP_000889093.1.65031 WP_000889093.1.6504 WP_000889093.1.6505 WP_000889093.1.65062 WP_000889093.1.65087 WP_000889093.1.65091 WP_000889093.1.65107 WP_000889093.1.65126 WP_000889093.1.65133 WP_000889093.1.65159 WP_000889093.1.65232 WP_000889093.1.65235 WP_000889093.1.65268 WP_000889093.1.65277 WP_000889093.1.6529 WP_000889093.1.65307 WP_000889093.1.65318 WP_000889093.1.65319 WP_000889093.1.6532 WP_000889093.1.65331 WP_000889093.1.65336 WP_000889093.1.65339 WP_000889093.1.65344 WP_000889093.1.65352 WP_000889093.1.65362 WP_000889093.1.65368 WP_000889093.1.6538 WP_000889093.1.65380 WP_000889093.1.65396 WP_000889093.1.65431 WP_000889093.1.65452 WP_000889093.1.65476 WP_000889093.1.65485 WP_000889093.1.65489 WP_000889093.1.65523 WP_000889093.1.65536 WP_000889093.1.65537 WP_000889093.1.65542 WP_000889093.1.65568 WP_000889093.1.65574 WP_000889093.1.65577 WP_000889093.1.65587 WP_000889093.1.65607 WP_000889093.1.65614 WP_000889093.1.65641 WP_000889093.1.65657 WP_000889093.1.65702 WP_000889093.1.65709 WP_000889093.1.65722 WP_000889093.1.65742 WP_000889093.1.65743 WP_000889093.1.65748 WP_000889093.1.6577 WP_000889093.1.65773 WP_000889093.1.65789 WP_000889093.1.65799 WP_000889093.1.658 WP_000889093.1.6580 WP_000889093.1.65806 WP_000889093.1.65829 WP_000889093.1.65853 WP_000889093.1.65859 WP_000889093.1.65887 WP_000889093.1.65897 WP_000889093.1.65916 WP_000889093.1.65920 WP_000889093.1.65936 WP_000889093.1.65941 WP_000889093.1.65944 WP_000889093.1.65960 WP_000889093.1.65971 WP_000889093.1.65982 WP_000889093.1.66003 WP_000889093.1.66006 WP_000889093.1.66045 WP_000889093.1.66046 WP_000889093.1.66053 WP_000889093.1.66099 WP_000889093.1.66115 WP_000889093.1.66132 WP_000889093.1.66135 WP_000889093.1.66139 WP_000889093.1.66164 WP_000889093.1.66166 WP_000889093.1.66191 WP_000889093.1.66195 WP_000889093.1.66205 WP_000889093.1.66207 WP_000889093.1.6621 WP_000889093.1.66230 WP_000889093.1.6625 WP_000889093.1.66278 WP_000889093.1.663 WP_000889093.1.66307 WP_000889093.1.66309 WP_000889093.1.66310 WP_000889093.1.66333 WP_000889093.1.66356 WP_000889093.1.66381 WP_000889093.1.66399 WP_000889093.1.66468 WP_000889093.1.66477 WP_000889093.1.66490 WP_000889093.1.66497 WP_000889093.1.66536 WP_000889093.1.66569 WP_000889093.1.66571 WP_000889093.1.66586 WP_000889093.1.66595 WP_000889093.1.66637 WP_000889093.1.66640 WP_000889093.1.66653 WP_000889093.1.66654 WP_000889093.1.66674 WP_000889093.1.66683 WP_000889093.1.66685 WP_000889093.1.66687 WP_000889093.1.66688 WP_000889093.1.66694 WP_000889093.1.66734 WP_000889093.1.66745 WP_000889093.1.66757 WP_000889093.1.66764 WP_000889093.1.66781 WP_000889093.1.6679 WP_000889093.1.66813 WP_000889093.1.66829 WP_000889093.1.66835 WP_000889093.1.66852 WP_000889093.1.66861 WP_000889093.1.66894 WP_000889093.1.669 WP_000889093.1.66914 WP_000889093.1.66917 WP_000889093.1.6694 WP_000889093.1.6695 WP_000889093.1.66956 WP_000889093.1.66964 WP_000889093.1.66971 WP_000889093.1.66973 WP_000889093.1.66983 WP_000889093.1.66995 WP_000889093.1.67039 WP_000889093.1.67051 WP_000889093.1.67076 WP_000889093.1.67084 WP_000889093.1.67096 WP_000889093.1.67114 WP_000889093.1.67115 WP_000889093.1.67121 WP_000889093.1.67148 WP_000889093.1.67151 WP_000889093.1.67169 WP_000889093.1.67196 WP_000889093.1.67206 WP_000889093.1.67215 WP_000889093.1.67222 WP_000889093.1.673 WP_000889093.1.67302 WP_000889093.1.67304 WP_000889093.1.67349 WP_000889093.1.67389 WP_000889093.1.67398 WP_000889093.1.67401 WP_000889093.1.67416 WP_000889093.1.67432 WP_000889093.1.67443 WP_000889093.1.67498 WP_000889093.1.67508 WP_000889093.1.67510 WP_000889093.1.67515 WP_000889093.1.67541 WP_000889093.1.67565 WP_000889093.1.67583 WP_000889093.1.6759 WP_000889093.1.67594 WP_000889093.1.67613 WP_000889093.1.67648 WP_000889093.1.67655 WP_000889093.1.67684 WP_000889093.1.67697 WP_000889093.1.6773 WP_000889093.1.6776 WP_000889093.1.67761 WP_000889093.1.67793 WP_000889093.1.67807 WP_000889093.1.67831 WP_000889093.1.67840 WP_000889093.1.67881 WP_000889093.1.67885 WP_000889093.1.67921 WP_000889093.1.67930 WP_000889093.1.6795 WP_000889093.1.67950 WP_000889093.1.67965 WP_000889093.1.67967 WP_000889093.1.67979 WP_000889093.1.68002 WP_000889093.1.68017 WP_000889093.1.68021 WP_000889093.1.68048 WP_000889093.1.68061 WP_000889093.1.68077 WP_000889093.1.68078 WP_000889093.1.68084 WP_000889093.1.681 WP_000889093.1.68103 WP_000889093.1.68104 WP_000889093.1.6812 WP_000889093.1.6821 WP_000889093.1.68220 WP_000889093.1.68238 WP_000889093.1.68245 WP_000889093.1.6826 WP_000889093.1.68287 WP_000889093.1.68306 WP_000889093.1.68310 WP_000889093.1.68323 WP_000889093.1.68352 WP_000889093.1.68363 WP_000889093.1.68393 WP_000889093.1.68406 WP_000889093.1.68407 WP_000889093.1.68427 WP_000889093.1.68430 WP_000889093.1.68431 WP_000889093.1.68453 WP_000889093.1.68458 WP_000889093.1.68464 WP_000889093.1.68469 WP_000889093.1.68494 WP_000889093.1.68503 WP_000889093.1.68508 WP_000889093.1.68531 WP_000889093.1.68535 WP_000889093.1.68544 WP_000889093.1.68557 WP_000889093.1.68560 WP_000889093.1.68567 WP_000889093.1.68578 WP_000889093.1.68595 WP_000889093.1.68596 WP_000889093.1.68597 WP_000889093.1.68600 WP_000889093.1.68622 WP_000889093.1.68639 WP_000889093.1.68644 WP_000889093.1.68653 WP_000889093.1.68660 WP_000889093.1.68661 WP_000889093.1.68671 WP_000889093.1.68682 WP_000889093.1.68686 WP_000889093.1.68689 WP_000889093.1.68712 WP_000889093.1.68721 WP_000889093.1.68729 WP_000889093.1.68755 WP_000889093.1.68777 WP_000889093.1.68784 WP_000889093.1.68807 WP_000889093.1.68812 WP_000889093.1.68814 WP_000889093.1.68819 WP_000889093.1.68835 WP_000889093.1.68851 WP_000889093.1.68852 WP_000889093.1.68853 WP_000889093.1.68868 WP_000889093.1.68872 WP_000889093.1.6890 WP_000889093.1.68939 WP_000889093.1.6894 WP_000889093.1.68960 WP_000889093.1.68963 WP_000889093.1.68992 WP_000889093.1.69 WP_000889093.1.69000 WP_000889093.1.69005 WP_000889093.1.69017 WP_000889093.1.69057 WP_000889093.1.69063 WP_000889093.1.69065 WP_000889093.1.69073 WP_000889093.1.69097 WP_000889093.1.69104 WP_000889093.1.69116 WP_000889093.1.69137 WP_000889093.1.69149 WP_000889093.1.69211 WP_000889093.1.69224 WP_000889093.1.69235 WP_000889093.1.69241 WP_000889093.1.69246 WP_000889093.1.6925 WP_000889093.1.69292 WP_000889093.1.69313 WP_000889093.1.69321 WP_000889093.1.69326 WP_000889093.1.69399 WP_000889093.1.69407 WP_000889093.1.69416 WP_000889093.1.69420 WP_000889093.1.69428 WP_000889093.1.69431 WP_000889093.1.6948 WP_000889093.1.69482 WP_000889093.1.69486 WP_000889093.1.69493 WP_000889093.1.69499 WP_000889093.1.69504 WP_000889093.1.69531 WP_000889093.1.69541 WP_000889093.1.69543 WP_000889093.1.69557 WP_000889093.1.69560 WP_000889093.1.69591 WP_000889093.1.69608 WP_000889093.1.6961 WP_000889093.1.69626 WP_000889093.1.69653 WP_000889093.1.69668 WP_000889093.1.69670 WP_000889093.1.69671 WP_000889093.1.69687 WP_000889093.1.6969 WP_000889093.1.69695 WP_000889093.1.6970 WP_000889093.1.69714 WP_000889093.1.69715 WP_000889093.1.69731 WP_000889093.1.69752 WP_000889093.1.69757 WP_000889093.1.69797 WP_000889093.1.69798 WP_000889093.1.69825 WP_000889093.1.69850 WP_000889093.1.69863 WP_000889093.1.69866 WP_000889093.1.69869 WP_000889093.1.6988 WP_000889093.1.69905 WP_000889093.1.69917 WP_000889093.1.69940 WP_000889093.1.69946 WP_000889093.1.69954 WP_000889093.1.69962 WP_000889093.1.69998 WP_000889093.1.7 WP_000889093.1.70001 WP_000889093.1.70011 WP_000889093.1.70020 WP_000889093.1.70046 WP_000889093.1.70051 WP_000889093.1.70056 WP_000889093.1.70057 WP_000889093.1.70060 WP_000889093.1.70075 WP_000889093.1.7008 WP_000889093.1.70110 WP_000889093.1.70119 WP_000889093.1.70121 WP_000889093.1.70142 WP_000889093.1.70150 WP_000889093.1.70156 WP_000889093.1.70166 WP_000889093.1.7018 WP_000889093.1.70192 WP_000889093.1.70199 WP_000889093.1.70214 WP_000889093.1.70221 WP_000889093.1.70223 WP_000889093.1.70224 WP_000889093.1.70233 WP_000889093.1.70267 WP_000889093.1.70277 WP_000889093.1.70279 WP_000889093.1.70298 WP_000889093.1.70302 WP_000889093.1.70307 WP_000889093.1.70308 WP_000889093.1.70315 WP_000889093.1.70316 WP_000889093.1.70329 WP_000889093.1.70336 WP_000889093.1.70360 WP_000889093.1.70400 WP_000889093.1.70409 WP_000889093.1.70421 WP_000889093.1.70436 WP_000889093.1.7047 WP_000889093.1.70486 WP_000889093.1.70490 WP_000889093.1.70508 WP_000889093.1.70513 WP_000889093.1.70515 WP_000889093.1.70520 WP_000889093.1.70524 WP_000889093.1.70528 WP_000889093.1.70532 WP_000889093.1.70535 WP_000889093.1.70536 WP_000889093.1.70538 WP_000889093.1.70557 WP_000889093.1.70567 WP_000889093.1.7057 WP_000889093.1.70574 WP_000889093.1.7059 WP_000889093.1.70617 WP_000889093.1.70620 WP_000889093.1.70629 WP_000889093.1.70630 WP_000889093.1.70674 WP_000889093.1.70707 WP_000889093.1.70741 WP_000889093.1.7075 WP_000889093.1.7076 WP_000889093.1.70766 WP_000889093.1.70771 WP_000889093.1.70802 WP_000889093.1.7081 WP_000889093.1.70828 WP_000889093.1.70838 WP_000889093.1.70851 WP_000889093.1.70867 WP_000889093.1.70876 WP_000889093.1.70887 WP_000889093.1.70904 WP_000889093.1.70916 WP_000889093.1.70931 WP_000889093.1.70942 WP_000889093.1.70951 WP_000889093.1.70961 WP_000889093.1.70987 WP_000889093.1.70988 WP_000889093.1.71014 WP_000889093.1.71017 WP_000889093.1.71020 WP_000889093.1.71051 WP_000889093.1.71060 WP_000889093.1.71078 WP_000889093.1.71082 WP_000889093.1.71084 WP_000889093.1.71093 WP_000889093.1.71133 WP_000889093.1.71177 WP_000889093.1.71178 WP_000889093.1.71195 WP_000889093.1.71206 WP_000889093.1.71211 WP_000889093.1.7126 WP_000889093.1.71270 WP_000889093.1.71277 WP_000889093.1.71283 WP_000889093.1.71360 WP_000889093.1.71415 WP_000889093.1.71436 WP_000889093.1.71460 WP_000889093.1.71534 WP_000889093.1.71551 WP_000889093.1.71565 WP_000889093.1.71571 WP_000889093.1.71574 WP_000889093.1.71598 WP_000889093.1.71605 WP_000889093.1.71622 WP_000889093.1.71659 WP_000889093.1.71663 WP_000889093.1.7167 WP_000889093.1.71673 WP_000889093.1.71685 WP_000889093.1.71697 WP_000889093.1.7173 WP_000889093.1.71742 WP_000889093.1.71773 WP_000889093.1.71785 WP_000889093.1.71787 WP_000889093.1.71808 WP_000889093.1.71818 WP_000889093.1.71824 WP_000889093.1.71841 WP_000889093.1.71849 WP_000889093.1.71869 WP_000889093.1.71870 WP_000889093.1.71879 WP_000889093.1.7188 WP_000889093.1.71880 WP_000889093.1.71883 WP_000889093.1.71905 WP_000889093.1.71926 WP_000889093.1.71959 WP_000889093.1.71977 WP_000889093.1.72009 WP_000889093.1.72071 WP_000889093.1.72082 WP_000889093.1.72088 WP_000889093.1.72095 WP_000889093.1.72135 WP_000889093.1.72145 WP_000889093.1.72147 WP_000889093.1.72160 WP_000889093.1.72163 WP_000889093.1.72192 WP_000889093.1.72233 WP_000889093.1.72235 WP_000889093.1.72242 WP_000889093.1.72251 WP_000889093.1.72309 WP_000889093.1.72321 WP_000889093.1.72329 WP_000889093.1.72368 WP_000889093.1.72390 WP_000889093.1.72404 WP_000889093.1.72407 WP_000889093.1.72416 WP_000889093.1.72421 WP_000889093.1.72454 WP_000889093.1.7247 WP_000889093.1.72472 WP_000889093.1.72474 WP_000889093.1.72502 WP_000889093.1.72534 WP_000889093.1.72542 WP_000889093.1.72561 WP_000889093.1.72565 WP_000889093.1.72595 WP_000889093.1.72610 WP_000889093.1.7262 WP_000889093.1.72628 WP_000889093.1.72630 WP_000889093.1.72646 WP_000889093.1.7268 WP_000889093.1.727 WP_000889093.1.72705 WP_000889093.1.7271 WP_000889093.1.72712 WP_000889093.1.72736 WP_000889093.1.72769 WP_000889093.1.72781 WP_000889093.1.72785 WP_000889093.1.7279 WP_000889093.1.7282 WP_000889093.1.72825 WP_000889093.1.72854 WP_000889093.1.72855 WP_000889093.1.72890 WP_000889093.1.72900 WP_000889093.1.72911 WP_000889093.1.72922 WP_000889093.1.72926 WP_000889093.1.72932 WP_000889093.1.72934 WP_000889093.1.72940 WP_000889093.1.72942 WP_000889093.1.72978 WP_000889093.1.72985 WP_000889093.1.7299 WP_000889093.1.7300 WP_000889093.1.73008 WP_000889093.1.73012 WP_000889093.1.73027 WP_000889093.1.73043 WP_000889093.1.73051 WP_000889093.1.73058 WP_000889093.1.73071 WP_000889093.1.73089 WP_000889093.1.73093 WP_000889093.1.73099 WP_000889093.1.7310 WP_000889093.1.73100 WP_000889093.1.73101 WP_000889093.1.73106 WP_000889093.1.73133 WP_000889093.1.73178 WP_000889093.1.73181 WP_000889093.1.732 WP_000889093.1.73209 WP_000889093.1.73214 WP_000889093.1.73226 WP_000889093.1.73288 WP_000889093.1.73322 WP_000889093.1.73336 WP_000889093.1.73356 WP_000889093.1.73357 WP_000889093.1.73359 WP_000889093.1.73369 WP_000889093.1.73384 WP_000889093.1.73419 WP_000889093.1.73433 WP_000889093.1.73438 WP_000889093.1.73462 WP_000889093.1.7347 WP_000889093.1.73476 WP_000889093.1.73500 WP_000889093.1.73502 WP_000889093.1.73509 WP_000889093.1.7352 WP_000889093.1.73520 WP_000889093.1.73522 WP_000889093.1.73525 WP_000889093.1.73543 WP_000889093.1.73548 WP_000889093.1.73554 WP_000889093.1.73559 WP_000889093.1.73567 WP_000889093.1.73568 WP_000889093.1.73588 WP_000889093.1.7359 WP_000889093.1.73593 WP_000889093.1.73622 WP_000889093.1.73665 WP_000889093.1.73666 WP_000889093.1.73675 WP_000889093.1.73710 WP_000889093.1.73725 WP_000889093.1.73726 WP_000889093.1.73771 WP_000889093.1.73777 WP_000889093.1.73796 WP_000889093.1.73800 WP_000889093.1.73812 WP_000889093.1.73825 WP_000889093.1.73851 WP_000889093.1.73890 WP_000889093.1.73903 WP_000889093.1.73907 WP_000889093.1.73913 WP_000889093.1.73923 WP_000889093.1.73939 WP_000889093.1.7397 WP_000889093.1.73979 WP_000889093.1.73982 WP_000889093.1.74011 WP_000889093.1.74014 WP_000889093.1.74015 WP_000889093.1.74033 WP_000889093.1.74069 WP_000889093.1.74075 WP_000889093.1.74084 WP_000889093.1.7409 WP_000889093.1.74128 WP_000889093.1.74139 WP_000889093.1.7415 WP_000889093.1.7416 WP_000889093.1.7420 WP_000889093.1.74206 WP_000889093.1.74208 WP_000889093.1.74231 WP_000889093.1.74239 WP_000889093.1.74250 WP_000889093.1.74260 WP_000889093.1.74293 WP_000889093.1.74308 WP_000889093.1.7431 WP_000889093.1.74330 WP_000889093.1.74331 WP_000889093.1.74341 WP_000889093.1.74363 WP_000889093.1.74364 WP_000889093.1.74385 WP_000889093.1.74396 WP_000889093.1.74399 WP_000889093.1.74419 WP_000889093.1.74437 WP_000889093.1.74443 WP_000889093.1.74459 WP_000889093.1.74471 WP_000889093.1.7449 WP_000889093.1.74496 WP_000889093.1.74516 WP_000889093.1.74537 WP_000889093.1.74548 WP_000889093.1.74550 WP_000889093.1.74582 WP_000889093.1.74618 WP_000889093.1.74633 WP_000889093.1.7466 WP_000889093.1.74679 WP_000889093.1.7468 WP_000889093.1.74780 WP_000889093.1.74822 WP_000889093.1.74848 WP_000889093.1.7485 WP_000889093.1.74855 WP_000889093.1.74877 WP_000889093.1.7488 WP_000889093.1.74906 WP_000889093.1.74928 WP_000889093.1.74940 WP_000889093.1.7497 WP_000889093.1.7503 WP_000889093.1.75031 WP_000889093.1.75049 WP_000889093.1.7505 WP_000889093.1.75062 WP_000889093.1.75074 WP_000889093.1.75085 WP_000889093.1.75088 WP_000889093.1.75094 WP_000889093.1.75096 WP_000889093.1.75099 WP_000889093.1.75102 WP_000889093.1.75123 WP_000889093.1.75130 WP_000889093.1.75156 WP_000889093.1.75165 WP_000889093.1.7517 WP_000889093.1.75259 WP_000889093.1.75260 WP_000889093.1.75284 WP_000889093.1.75302 WP_000889093.1.75314 WP_000889093.1.75317 WP_000889093.1.75325 WP_000889093.1.75335 WP_000889093.1.75336 WP_000889093.1.75354 WP_000889093.1.75355 WP_000889093.1.75370 WP_000889093.1.75401 WP_000889093.1.75406 WP_000889093.1.75445 WP_000889093.1.75455 WP_000889093.1.75464 WP_000889093.1.75469 WP_000889093.1.7548 WP_000889093.1.75490 WP_000889093.1.75500 WP_000889093.1.75511 WP_000889093.1.75522 WP_000889093.1.75534 WP_000889093.1.7554 WP_000889093.1.75546 WP_000889093.1.75547 WP_000889093.1.75558 WP_000889093.1.75582 WP_000889093.1.75586 WP_000889093.1.75601 WP_000889093.1.75632 WP_000889093.1.75648 WP_000889093.1.75654 WP_000889093.1.75675 WP_000889093.1.75691 WP_000889093.1.75701 WP_000889093.1.75709 WP_000889093.1.75729 WP_000889093.1.7573 WP_000889093.1.75752 WP_000889093.1.75755 WP_000889093.1.75817 WP_000889093.1.75834 WP_000889093.1.75845 WP_000889093.1.75857 WP_000889093.1.75876 WP_000889093.1.75877 WP_000889093.1.75880 WP_000889093.1.75897 WP_000889093.1.75899 WP_000889093.1.75904 WP_000889093.1.75907 WP_000889093.1.75955 WP_000889093.1.75982 WP_000889093.1.75987 WP_000889093.1.75996 WP_000889093.1.76003 WP_000889093.1.76017 WP_000889093.1.76018 WP_000889093.1.76051 WP_000889093.1.76067 WP_000889093.1.76068 WP_000889093.1.76080 WP_000889093.1.76093 WP_000889093.1.76154 WP_000889093.1.76161 WP_000889093.1.76166 WP_000889093.1.76195 WP_000889093.1.76202 WP_000889093.1.76220 WP_000889093.1.76251 WP_000889093.1.76264 WP_000889093.1.76265 WP_000889093.1.76289 WP_000889093.1.76293 WP_000889093.1.76303 WP_000889093.1.76344 WP_000889093.1.76357 WP_000889093.1.76377 WP_000889093.1.76393 WP_000889093.1.7640 WP_000889093.1.76409 WP_000889093.1.76429 WP_000889093.1.76439 WP_000889093.1.76440 WP_000889093.1.76454 WP_000889093.1.76458 WP_000889093.1.76499 WP_000889093.1.76530 WP_000889093.1.76564 WP_000889093.1.76570 WP_000889093.1.76577 WP_000889093.1.76594 WP_000889093.1.76614 WP_000889093.1.76631 WP_000889093.1.76649 WP_000889093.1.76650 WP_000889093.1.76675 WP_000889093.1.76692 WP_000889093.1.76722 WP_000889093.1.7673 WP_000889093.1.76761 WP_000889093.1.76764 WP_000889093.1.7678 WP_000889093.1.76780 WP_000889093.1.7679 WP_000889093.1.76830 WP_000889093.1.76837 WP_000889093.1.76850 WP_000889093.1.76857 WP_000889093.1.76862 WP_000889093.1.76868 WP_000889093.1.76927 WP_000889093.1.76942 WP_000889093.1.76972 WP_000889093.1.76980 WP_000889093.1.77 WP_000889093.1.77037 WP_000889093.1.77044 WP_000889093.1.77052 WP_000889093.1.7706 WP_000889093.1.77088 WP_000889093.1.77094 WP_000889093.1.77103 WP_000889093.1.77104 WP_000889093.1.77123 WP_000889093.1.7713 WP_000889093.1.77130 WP_000889093.1.77156 WP_000889093.1.77167 WP_000889093.1.77172 WP_000889093.1.77195 WP_000889093.1.77197 WP_000889093.1.77223 WP_000889093.1.77243 WP_000889093.1.7725 WP_000889093.1.77278 WP_000889093.1.77310 WP_000889093.1.7735 WP_000889093.1.77373 WP_000889093.1.77375 WP_000889093.1.77379 WP_000889093.1.7741 WP_000889093.1.77434 WP_000889093.1.77439 WP_000889093.1.77444 WP_000889093.1.77457 WP_000889093.1.77468 WP_000889093.1.77483 WP_000889093.1.77505 WP_000889093.1.77534 WP_000889093.1.77535 WP_000889093.1.77552 WP_000889093.1.77568 WP_000889093.1.7761 WP_000889093.1.77610 WP_000889093.1.77637 WP_000889093.1.77663 WP_000889093.1.77664 WP_000889093.1.77670 WP_000889093.1.77724 WP_000889093.1.77731 WP_000889093.1.77747 WP_000889093.1.77755 WP_000889093.1.77765 WP_000889093.1.77779 WP_000889093.1.77780 WP_000889093.1.77789 WP_000889093.1.77847 WP_000889093.1.77870 WP_000889093.1.77872 WP_000889093.1.77877 WP_000889093.1.77894 WP_000889093.1.77906 WP_000889093.1.77912 WP_000889093.1.77939 WP_000889093.1.77944 WP_000889093.1.77976 WP_000889093.1.77982 WP_000889093.1.78003 WP_000889093.1.78025 WP_000889093.1.7803 WP_000889093.1.78030 WP_000889093.1.78058 WP_000889093.1.78068 WP_000889093.1.78078 WP_000889093.1.78087 WP_000889093.1.78108 WP_000889093.1.7812 WP_000889093.1.78129 WP_000889093.1.7813 WP_000889093.1.78139 WP_000889093.1.78169 WP_000889093.1.78191 WP_000889093.1.78211 WP_000889093.1.78253 WP_000889093.1.78275 WP_000889093.1.7828 WP_000889093.1.78298 WP_000889093.1.78343 WP_000889093.1.78349 WP_000889093.1.78379 WP_000889093.1.7838 WP_000889093.1.78395 WP_000889093.1.78397 WP_000889093.1.78422 WP_000889093.1.78444 WP_000889093.1.78454 WP_000889093.1.78455 WP_000889093.1.78457 WP_000889093.1.7846 WP_000889093.1.78465 WP_000889093.1.78467 WP_000889093.1.78475 WP_000889093.1.78535 WP_000889093.1.78541 WP_000889093.1.78546 WP_000889093.1.78563 WP_000889093.1.78588 WP_000889093.1.78609 WP_000889093.1.78656 WP_000889093.1.78710 WP_000889093.1.78720 WP_000889093.1.78724 WP_000889093.1.78733 WP_000889093.1.78737 WP_000889093.1.78755 WP_000889093.1.78762 WP_000889093.1.78794 WP_000889093.1.78828 WP_000889093.1.78832 WP_000889093.1.78865 WP_000889093.1.78866 WP_000889093.1.78870 WP_000889093.1.78876 WP_000889093.1.78887 WP_000889093.1.78889 WP_000889093.1.78915 WP_000889093.1.78939 WP_000889093.1.78965 WP_000889093.1.78976 WP_000889093.1.78979 WP_000889093.1.79008 WP_000889093.1.79040 WP_000889093.1.79073 WP_000889093.1.79079 WP_000889093.1.79080 WP_000889093.1.79096 WP_000889093.1.7910 WP_000889093.1.79124 WP_000889093.1.79134 WP_000889093.1.7915 WP_000889093.1.79157 WP_000889093.1.79169 WP_000889093.1.79173 WP_000889093.1.79187 WP_000889093.1.79202 WP_000889093.1.79228 WP_000889093.1.7924 WP_000889093.1.79245 WP_000889093.1.79298 WP_000889093.1.79316 WP_000889093.1.79329 WP_000889093.1.79338 WP_000889093.1.79349 WP_000889093.1.7941 WP_000889093.1.79418 WP_000889093.1.79419 WP_000889093.1.79451 WP_000889093.1.79469 WP_000889093.1.79475 WP_000889093.1.79496 WP_000889093.1.7950 WP_000889093.1.7954 WP_000889093.1.79546 WP_000889093.1.7959 WP_000889093.1.79612 WP_000889093.1.79616 WP_000889093.1.79637 WP_000889093.1.79669 WP_000889093.1.79671 WP_000889093.1.79675 WP_000889093.1.7968 WP_000889093.1.79690 WP_000889093.1.79693 WP_000889093.1.79705 WP_000889093.1.79732 WP_000889093.1.79746 WP_000889093.1.79748 WP_000889093.1.79767 WP_000889093.1.79793 WP_000889093.1.798 WP_000889093.1.79841 WP_000889093.1.79849 WP_000889093.1.79858 WP_000889093.1.79895 WP_000889093.1.79927 WP_000889093.1.79940 WP_000889093.1.7998 WP_000889093.1.80005 WP_000889093.1.80019 WP_000889093.1.8003 WP_000889093.1.80049 WP_000889093.1.80070 WP_000889093.1.80093 WP_000889093.1.80130 WP_000889093.1.80134 WP_000889093.1.80148 WP_000889093.1.8015 WP_000889093.1.80161 WP_000889093.1.80186 WP_000889093.1.80190 WP_000889093.1.80191 WP_000889093.1.80200 WP_000889093.1.80207 WP_000889093.1.80211 WP_000889093.1.80228 WP_000889093.1.80231 WP_000889093.1.80251 WP_000889093.1.80256 WP_000889093.1.80261 WP_000889093.1.80268 WP_000889093.1.80279 WP_000889093.1.80294 WP_000889093.1.80314 WP_000889093.1.8032 WP_000889093.1.80321 WP_000889093.1.80328 WP_000889093.1.80349 WP_000889093.1.80357 WP_000889093.1.80364 WP_000889093.1.80367 WP_000889093.1.80372 WP_000889093.1.80373 WP_000889093.1.8041 WP_000889093.1.80449 WP_000889093.1.80457 WP_000889093.1.80467 WP_000889093.1.80475 WP_000889093.1.8048 WP_000889093.1.80495 WP_000889093.1.80532 WP_000889093.1.80538 WP_000889093.1.80539 WP_000889093.1.80550 WP_000889093.1.80557 WP_000889093.1.80596 WP_000889093.1.80597 WP_000889093.1.80613 WP_000889093.1.80619 WP_000889093.1.80691 WP_000889093.1.80700 WP_000889093.1.80758 WP_000889093.1.80765 WP_000889093.1.80775 WP_000889093.1.80856 WP_000889093.1.80875 WP_000889093.1.80885 WP_000889093.1.80903 WP_000889093.1.80914 WP_000889093.1.80919 WP_000889093.1.80949 WP_000889093.1.80990 WP_000889093.1.80996 WP_000889093.1.8101 WP_000889093.1.81012 WP_000889093.1.81033 WP_000889093.1.81048 WP_000889093.1.8109 WP_000889093.1.81117 WP_000889093.1.81134 WP_000889093.1.81179 WP_000889093.1.81190 WP_000889093.1.81201 WP_000889093.1.81236 WP_000889093.1.81241 WP_000889093.1.81292 WP_000889093.1.81296 WP_000889093.1.81309 WP_000889093.1.81314 WP_000889093.1.81343 WP_000889093.1.81367 WP_000889093.1.81369 WP_000889093.1.81375 WP_000889093.1.81381 WP_000889093.1.81395 WP_000889093.1.81398 WP_000889093.1.81408 WP_000889093.1.81473 WP_000889093.1.81481 WP_000889093.1.81483 WP_000889093.1.81492 WP_000889093.1.815 WP_000889093.1.81500 WP_000889093.1.81530 WP_000889093.1.81533 WP_000889093.1.81534 WP_000889093.1.81545 WP_000889093.1.81550 WP_000889093.1.81573 WP_000889093.1.81585 WP_000889093.1.81586 WP_000889093.1.81587 WP_000889093.1.81616 WP_000889093.1.81628 WP_000889093.1.81630 WP_000889093.1.81639 WP_000889093.1.8166 WP_000889093.1.81694 WP_000889093.1.81703 WP_000889093.1.81707 WP_000889093.1.81716 WP_000889093.1.81724 WP_000889093.1.81729 WP_000889093.1.81733 WP_000889093.1.81745 WP_000889093.1.81769 WP_000889093.1.81775 WP_000889093.1.81781 WP_000889093.1.81807 WP_000889093.1.81817 WP_000889093.1.81857 WP_000889093.1.81890 WP_000889093.1.81894 WP_000889093.1.81959 WP_000889093.1.81962 WP_000889093.1.81967 WP_000889093.1.81984 WP_000889093.1.82005 WP_000889093.1.82016 WP_000889093.1.82020 WP_000889093.1.82029 WP_000889093.1.82033 WP_000889093.1.82042 WP_000889093.1.82049 WP_000889093.1.82051 WP_000889093.1.82094 WP_000889093.1.82140 WP_000889093.1.82181 WP_000889093.1.82189 WP_000889093.1.82191 WP_000889093.1.82195 WP_000889093.1.8221 WP_000889093.1.82212 WP_000889093.1.82213 WP_000889093.1.82229 WP_000889093.1.82252 WP_000889093.1.82255 WP_000889093.1.82297 WP_000889093.1.82298 WP_000889093.1.823 WP_000889093.1.82302 WP_000889093.1.82306 WP_000889093.1.82342 WP_000889093.1.82345 WP_000889093.1.82353 WP_000889093.1.82382 WP_000889093.1.82386 WP_000889093.1.82407 WP_000889093.1.82422 WP_000889093.1.82423 WP_000889093.1.82437 WP_000889093.1.82459 WP_000889093.1.8248 WP_000889093.1.82481 WP_000889093.1.82502 WP_000889093.1.82505 WP_000889093.1.82518 WP_000889093.1.82537 WP_000889093.1.82552 WP_000889093.1.82557 WP_000889093.1.82563 WP_000889093.1.82564 WP_000889093.1.8257 WP_000889093.1.82600 WP_000889093.1.82603 WP_000889093.1.82650 WP_000889093.1.82660 WP_000889093.1.82666 WP_000889093.1.82680 WP_000889093.1.82684 WP_000889093.1.82693 WP_000889093.1.82699 WP_000889093.1.82702 WP_000889093.1.82732 WP_000889093.1.82733 WP_000889093.1.82736 WP_000889093.1.8275 WP_000889093.1.82750 WP_000889093.1.82758 WP_000889093.1.8276 WP_000889093.1.82771 WP_000889093.1.82783 WP_000889093.1.82792 WP_000889093.1.82793 WP_000889093.1.82818 WP_000889093.1.82827 WP_000889093.1.82840 WP_000889093.1.82845 WP_000889093.1.82847 WP_000889093.1.82869 WP_000889093.1.82877 WP_000889093.1.82885 WP_000889093.1.82900 WP_000889093.1.8293 WP_000889093.1.82958 WP_000889093.1.82969 WP_000889093.1.82970 WP_000889093.1.82971 WP_000889093.1.82985 WP_000889093.1.83042 WP_000889093.1.83055 WP_000889093.1.83064 WP_000889093.1.83094 WP_000889093.1.83107 WP_000889093.1.83111 WP_000889093.1.83115 WP_000889093.1.83135 WP_000889093.1.83136 WP_000889093.1.8315 WP_000889093.1.83158 WP_000889093.1.8316 WP_000889093.1.83164 WP_000889093.1.83168 WP_000889093.1.83174 WP_000889093.1.83183 WP_000889093.1.83189 WP_000889093.1.83199 WP_000889093.1.83219 WP_000889093.1.83242 WP_000889093.1.83244 WP_000889093.1.83281 WP_000889093.1.83306 WP_000889093.1.83311 WP_000889093.1.83319 WP_000889093.1.83324 WP_000889093.1.83335 WP_000889093.1.83371 WP_000889093.1.83432 WP_000889093.1.83439 WP_000889093.1.83443 WP_000889093.1.83446 WP_000889093.1.83455 WP_000889093.1.83456 WP_000889093.1.83457 WP_000889093.1.83471 WP_000889093.1.83485 WP_000889093.1.83489 WP_000889093.1.83527 WP_000889093.1.83565 WP_000889093.1.83574 WP_000889093.1.83578 WP_000889093.1.83586 WP_000889093.1.8360 WP_000889093.1.83604 WP_000889093.1.83606 WP_000889093.1.83634 WP_000889093.1.83635 WP_000889093.1.83636 WP_000889093.1.83681 WP_000889093.1.83713 WP_000889093.1.83719 WP_000889093.1.83726 WP_000889093.1.83730 WP_000889093.1.83731 WP_000889093.1.83732 WP_000889093.1.83752 WP_000889093.1.83789 WP_000889093.1.83790 WP_000889093.1.83796 WP_000889093.1.83840 WP_000889093.1.83843 WP_000889093.1.83846 WP_000889093.1.83866 WP_000889093.1.83888 WP_000889093.1.83898 WP_000889093.1.83899 WP_000889093.1.8392 WP_000889093.1.83922 WP_000889093.1.83934 WP_000889093.1.83956 WP_000889093.1.83961 WP_000889093.1.83964 WP_000889093.1.83974 WP_000889093.1.83978 WP_000889093.1.8398 WP_000889093.1.84013 WP_000889093.1.84017 WP_000889093.1.84019 WP_000889093.1.84038 WP_000889093.1.84052 WP_000889093.1.84056 WP_000889093.1.84061 WP_000889093.1.84065 WP_000889093.1.84080 WP_000889093.1.84092 WP_000889093.1.84095 WP_000889093.1.84113 WP_000889093.1.84116 WP_000889093.1.84125 WP_000889093.1.84147 WP_000889093.1.8416 WP_000889093.1.84175 WP_000889093.1.84182 WP_000889093.1.84213 WP_000889093.1.84214 WP_000889093.1.84225 WP_000889093.1.8423 WP_000889093.1.84237 WP_000889093.1.84258 WP_000889093.1.84263 WP_000889093.1.84292 WP_000889093.1.84304 WP_000889093.1.84305 WP_000889093.1.84321 WP_000889093.1.84353 WP_000889093.1.84363 WP_000889093.1.84382 WP_000889093.1.84444 WP_000889093.1.84477 WP_000889093.1.84505 WP_000889093.1.84513 WP_000889093.1.84530 WP_000889093.1.8454 WP_000889093.1.84552 WP_000889093.1.846 WP_000889093.1.84613 WP_000889093.1.84633 WP_000889093.1.84636 WP_000889093.1.84640 WP_000889093.1.84643 WP_000889093.1.84658 WP_000889093.1.84664 WP_000889093.1.84667 WP_000889093.1.84669 WP_000889093.1.84672 WP_000889093.1.84724 WP_000889093.1.84746 WP_000889093.1.84747 WP_000889093.1.8481 WP_000889093.1.84821 WP_000889093.1.84827 WP_000889093.1.84842 WP_000889093.1.84858 WP_000889093.1.8486 WP_000889093.1.84897 WP_000889093.1.84910 WP_000889093.1.84931 WP_000889093.1.84955 WP_000889093.1.84979 WP_000889093.1.84991 WP_000889093.1.84998 WP_000889093.1.8500 WP_000889093.1.85019 WP_000889093.1.85021 WP_000889093.1.85033 WP_000889093.1.8506 WP_000889093.1.85061 WP_000889093.1.85062 WP_000889093.1.85064 WP_000889093.1.8507 WP_000889093.1.85095 WP_000889093.1.8510 WP_000889093.1.85103 WP_000889093.1.85111 WP_000889093.1.85114 WP_000889093.1.85123 WP_000889093.1.85174 WP_000889093.1.85184 WP_000889093.1.85195 WP_000889093.1.85212 WP_000889093.1.85215 WP_000889093.1.85221 WP_000889093.1.85232 WP_000889093.1.85233 WP_000889093.1.8524 WP_000889093.1.85250 WP_000889093.1.85286 WP_000889093.1.8534 WP_000889093.1.85373 WP_000889093.1.85379 WP_000889093.1.85392 WP_000889093.1.85393 WP_000889093.1.85400 WP_000889093.1.85418 WP_000889093.1.85427 WP_000889093.1.85434 WP_000889093.1.85452 WP_000889093.1.8547 WP_000889093.1.85470 WP_000889093.1.85494 WP_000889093.1.85496 WP_000889093.1.85508 WP_000889093.1.85522 WP_000889093.1.85526 WP_000889093.1.85548 WP_000889093.1.85552 WP_000889093.1.85581 WP_000889093.1.85588 WP_000889093.1.85608 WP_000889093.1.85609 WP_000889093.1.85613 WP_000889093.1.85624 WP_000889093.1.85625 WP_000889093.1.85629 WP_000889093.1.85652 WP_000889093.1.85659 WP_000889093.1.85661 WP_000889093.1.8569 WP_000889093.1.85697 WP_000889093.1.85718 WP_000889093.1.8574 WP_000889093.1.85745 WP_000889093.1.85750 WP_000889093.1.85789 WP_000889093.1.85849 WP_000889093.1.85861 WP_000889093.1.85869 WP_000889093.1.85880 WP_000889093.1.85881 WP_000889093.1.85882 WP_000889093.1.85907 WP_000889093.1.85918 WP_000889093.1.85921 WP_000889093.1.85942 WP_000889093.1.85962 WP_000889093.1.85973 WP_000889093.1.86013 WP_000889093.1.86020 WP_000889093.1.86040 WP_000889093.1.86061 WP_000889093.1.86075 WP_000889093.1.86081 WP_000889093.1.86118 WP_000889093.1.8612 WP_000889093.1.86130 WP_000889093.1.8618 WP_000889093.1.86211 WP_000889093.1.86223 WP_000889093.1.86237 WP_000889093.1.86238 WP_000889093.1.86254 WP_000889093.1.86268 WP_000889093.1.86296 WP_000889093.1.86300 WP_000889093.1.86309 WP_000889093.1.86312 WP_000889093.1.86320 WP_000889093.1.86326 WP_000889093.1.86330 WP_000889093.1.86346 WP_000889093.1.86403 WP_000889093.1.86445 WP_000889093.1.86456 WP_000889093.1.86457 WP_000889093.1.8646 WP_000889093.1.86496 WP_000889093.1.86507 WP_000889093.1.86529 WP_000889093.1.86539 WP_000889093.1.86546 WP_000889093.1.8655 WP_000889093.1.86558 WP_000889093.1.86612 WP_000889093.1.86614 WP_000889093.1.86631 WP_000889093.1.86632 WP_000889093.1.86636 WP_000889093.1.86655 WP_000889093.1.86659 WP_000889093.1.86685 WP_000889093.1.86689 WP_000889093.1.86702 WP_000889093.1.86721 WP_000889093.1.86722 WP_000889093.1.86723 WP_000889093.1.86724 WP_000889093.1.8674 WP_000889093.1.86742 WP_000889093.1.86747 WP_000889093.1.86750 WP_000889093.1.86751 WP_000889093.1.86772 WP_000889093.1.86784 WP_000889093.1.86798 WP_000889093.1.86812 WP_000889093.1.86841 WP_000889093.1.86866 WP_000889093.1.86875 WP_000889093.1.86880 WP_000889093.1.86887 WP_000889093.1.86913 WP_000889093.1.86918 WP_000889093.1.86939 WP_000889093.1.86953 WP_000889093.1.86996 WP_000889093.1.86998 WP_000889093.1.87065 WP_000889093.1.87069 WP_000889093.1.87073 WP_000889093.1.87077 WP_000889093.1.8708 WP_000889093.1.87084 WP_000889093.1.87094 WP_000889093.1.87138 WP_000889093.1.87160 WP_000889093.1.87174 WP_000889093.1.87186 WP_000889093.1.87200 WP_000889093.1.87229 WP_000889093.1.8724 WP_000889093.1.87289 WP_000889093.1.87297 WP_000889093.1.87332 WP_000889093.1.8734 WP_000889093.1.87342 WP_000889093.1.87347 WP_000889093.1.87351 WP_000889093.1.87352 WP_000889093.1.87421 WP_000889093.1.87422 WP_000889093.1.8744 WP_000889093.1.8747 WP_000889093.1.87510 WP_000889093.1.87521 WP_000889093.1.87548 WP_000889093.1.87550 WP_000889093.1.87575 WP_000889093.1.87592 WP_000889093.1.87604 WP_000889093.1.87621 WP_000889093.1.87661 WP_000889093.1.87681 WP_000889093.1.87731 WP_000889093.1.87771 WP_000889093.1.87774 WP_000889093.1.87775 WP_000889093.1.87792 WP_000889093.1.87799 WP_000889093.1.87815 WP_000889093.1.87829 WP_000889093.1.87833 WP_000889093.1.87839 WP_000889093.1.87863 WP_000889093.1.87868 WP_000889093.1.87872 WP_000889093.1.87904 WP_000889093.1.87909 WP_000889093.1.87910 WP_000889093.1.87922 WP_000889093.1.87942 WP_000889093.1.87971 WP_000889093.1.8799 WP_000889093.1.87993 WP_000889093.1.87998 WP_000889093.1.88033 WP_000889093.1.88054 WP_000889093.1.88103 WP_000889093.1.88113 WP_000889093.1.88129 WP_000889093.1.88141 WP_000889093.1.88167 WP_000889093.1.88170 WP_000889093.1.88172 WP_000889093.1.88176 WP_000889093.1.88182 WP_000889093.1.88196 WP_000889093.1.88203 WP_000889093.1.88206 WP_000889093.1.88218 WP_000889093.1.88228 WP_000889093.1.8823 WP_000889093.1.88232 WP_000889093.1.88246 WP_000889093.1.88343 WP_000889093.1.88365 WP_000889093.1.88387 WP_000889093.1.88391 WP_000889093.1.88433 WP_000889093.1.88468 WP_000889093.1.88509 WP_000889093.1.88523 WP_000889093.1.88533 WP_000889093.1.88544 WP_000889093.1.8858 WP_000889093.1.88586 WP_000889093.1.88602 WP_000889093.1.88652 WP_000889093.1.88662 WP_000889093.1.88669 WP_000889093.1.88695 WP_000889093.1.88697 WP_000889093.1.88699 WP_000889093.1.88700 WP_000889093.1.88716 WP_000889093.1.88719 WP_000889093.1.88722 WP_000889093.1.8876 WP_000889093.1.88811 WP_000889093.1.88825 WP_000889093.1.88840 WP_000889093.1.88841 WP_000889093.1.88862 WP_000889093.1.88932 WP_000889093.1.88939 WP_000889093.1.88940 WP_000889093.1.88963 WP_000889093.1.88984 WP_000889093.1.89016 WP_000889093.1.89029 WP_000889093.1.89032 WP_000889093.1.89034 WP_000889093.1.89094 WP_000889093.1.89123 WP_000889093.1.89134 WP_000889093.1.8914 WP_000889093.1.89161 WP_000889093.1.89190 WP_000889093.1.89208 WP_000889093.1.89210 WP_000889093.1.89253 WP_000889093.1.89254 WP_000889093.1.8926 WP_000889093.1.89294 WP_000889093.1.8930 WP_000889093.1.89310 WP_000889093.1.89346 WP_000889093.1.89375 WP_000889093.1.89442 WP_000889093.1.89444 WP_000889093.1.89489 WP_000889093.1.89498 WP_000889093.1.89504 WP_000889093.1.89525 WP_000889093.1.89532 WP_000889093.1.89539 WP_000889093.1.89555 WP_000889093.1.89563 WP_000889093.1.89585 WP_000889093.1.89620 WP_000889093.1.89624 WP_000889093.1.8963 WP_000889093.1.89645 WP_000889093.1.89649 WP_000889093.1.89652 WP_000889093.1.89654 WP_000889093.1.89658 WP_000889093.1.89681 WP_000889093.1.89684 WP_000889093.1.8970 WP_000889093.1.89702 WP_000889093.1.89708 WP_000889093.1.89720 WP_000889093.1.8973 WP_000889093.1.89741 WP_000889093.1.8975 WP_000889093.1.89763 WP_000889093.1.89806 WP_000889093.1.89828 WP_000889093.1.89837 WP_000889093.1.89843 WP_000889093.1.89850 WP_000889093.1.89858 WP_000889093.1.89864 WP_000889093.1.89875 WP_000889093.1.89881 WP_000889093.1.89887 WP_000889093.1.89891 WP_000889093.1.89905 WP_000889093.1.89913 WP_000889093.1.89942 WP_000889093.1.89945 WP_000889093.1.89967 WP_000889093.1.90001 WP_000889093.1.90010 WP_000889093.1.90028 WP_000889093.1.90053 WP_000889093.1.90059 WP_000889093.1.90062 WP_000889093.1.90071 WP_000889093.1.90113 WP_000889093.1.90119 WP_000889093.1.90124 WP_000889093.1.90143 WP_000889093.1.90163 WP_000889093.1.90178 WP_000889093.1.90197 WP_000889093.1.90202 WP_000889093.1.90213 WP_000889093.1.90228 WP_000889093.1.90234 WP_000889093.1.90261 WP_000889093.1.9027 WP_000889093.1.90304 WP_000889093.1.90312 WP_000889093.1.90313 WP_000889093.1.90319 WP_000889093.1.90339 WP_000889093.1.90356 WP_000889093.1.90361 WP_000889093.1.90385 WP_000889093.1.90397 WP_000889093.1.90410 WP_000889093.1.90425 WP_000889093.1.90443 WP_000889093.1.9045 WP_000889093.1.90463 WP_000889093.1.90482 WP_000889093.1.90495 WP_000889093.1.90501 WP_000889093.1.90502 WP_000889093.1.90529 WP_000889093.1.90539 WP_000889093.1.90565 WP_000889093.1.9057 WP_000889093.1.90577 WP_000889093.1.90583 WP_000889093.1.90597 WP_000889093.1.90603 WP_000889093.1.90606 WP_000889093.1.90615 WP_000889093.1.90618 WP_000889093.1.90628 WP_000889093.1.90676 WP_000889093.1.90678 WP_000889093.1.90693 WP_000889093.1.90695 WP_000889093.1.907 WP_000889093.1.90712 WP_000889093.1.90727 WP_000889093.1.90731 WP_000889093.1.90733 WP_000889093.1.90762 WP_000889093.1.90768 WP_000889093.1.90776 WP_000889093.1.90778 WP_000889093.1.90809 WP_000889093.1.90817 WP_000889093.1.90869 WP_000889093.1.90882 WP_000889093.1.90894 WP_000889093.1.90897 WP_000889093.1.90900 WP_000889093.1.90925 WP_000889093.1.90927 WP_000889093.1.90929 WP_000889093.1.90936 WP_000889093.1.90942 WP_000889093.1.90957 WP_000889093.1.90974 WP_000889093.1.90980 WP_000889093.1.90989 WP_000889093.1.91015 WP_000889093.1.91024 WP_000889093.1.91034 WP_000889093.1.91037 WP_000889093.1.91041 WP_000889093.1.91052 WP_000889093.1.91058 WP_000889093.1.91078 WP_000889093.1.91079 WP_000889093.1.9108 WP_000889093.1.91099 WP_000889093.1.91125 WP_000889093.1.91127 WP_000889093.1.91129 WP_000889093.1.91131 WP_000889093.1.91149 WP_000889093.1.9115 WP_000889093.1.91154 WP_000889093.1.91172 WP_000889093.1.91176 WP_000889093.1.91217 WP_000889093.1.9124 WP_000889093.1.91269 WP_000889093.1.91271 WP_000889093.1.91276 WP_000889093.1.91321 WP_000889093.1.91358 WP_000889093.1.91369 WP_000889093.1.91375 WP_000889093.1.91383 WP_000889093.1.91388 WP_000889093.1.91412 WP_000889093.1.91413 WP_000889093.1.91478 WP_000889093.1.91481 WP_000889093.1.91545 WP_000889093.1.91562 WP_000889093.1.9162 WP_000889093.1.91686 WP_000889093.1.91705 WP_000889093.1.91714 WP_000889093.1.91718 WP_000889093.1.91719 WP_000889093.1.9173 WP_000889093.1.91733 WP_000889093.1.91775 WP_000889093.1.91808 WP_000889093.1.91811 WP_000889093.1.91815 WP_000889093.1.91821 WP_000889093.1.91839 WP_000889093.1.9184 WP_000889093.1.91858 WP_000889093.1.91878 WP_000889093.1.91881 WP_000889093.1.91886 WP_000889093.1.91888 WP_000889093.1.9192 WP_000889093.1.91923 WP_000889093.1.91924 WP_000889093.1.91927 WP_000889093.1.91934 WP_000889093.1.91947 WP_000889093.1.91949 WP_000889093.1.91960 WP_000889093.1.91985 WP_000889093.1.92006 WP_000889093.1.92010 WP_000889093.1.92015 WP_000889093.1.92027 WP_000889093.1.92032 WP_000889093.1.92034 WP_000889093.1.92045 WP_000889093.1.92061 WP_000889093.1.92065 WP_000889093.1.92086 WP_000889093.1.92116 WP_000889093.1.92166 WP_000889093.1.92167 WP_000889093.1.92168 WP_000889093.1.92176 WP_000889093.1.92177 WP_000889093.1.92178 WP_000889093.1.92182 WP_000889093.1.92225 WP_000889093.1.92245 WP_000889093.1.92248 WP_000889093.1.9225 WP_000889093.1.92271 WP_000889093.1.92326 WP_000889093.1.92342 WP_000889093.1.92344 WP_000889093.1.92351 WP_000889093.1.92353 WP_000889093.1.92355 WP_000889093.1.92369 WP_000889093.1.92381 WP_000889093.1.92386 WP_000889093.1.92389 WP_000889093.1.92400 WP_000889093.1.92426 WP_000889093.1.92450 WP_000889093.1.92457 WP_000889093.1.92464 WP_000889093.1.92491 WP_000889093.1.92502 WP_000889093.1.92558 WP_000889093.1.92564 WP_000889093.1.92640 WP_000889093.1.92652 WP_000889093.1.92656 WP_000889093.1.92682 WP_000889093.1.92724 WP_000889093.1.92732 WP_000889093.1.92740 WP_000889093.1.9275 WP_000889093.1.92755 WP_000889093.1.92812 WP_000889093.1.92814 WP_000889093.1.92837 WP_000889093.1.92850 WP_000889093.1.92866 WP_000889093.1.92872 WP_000889093.1.92874 WP_000889093.1.92878 WP_000889093.1.92896 WP_000889093.1.92906 WP_000889093.1.92913 WP_000889093.1.92940 WP_000889093.1.92967 WP_000889093.1.92969 WP_000889093.1.9297 WP_000889093.1.92971 WP_000889093.1.92973 WP_000889093.1.9299 WP_000889093.1.93075 WP_000889093.1.93084 WP_000889093.1.93096 WP_000889093.1.93108 WP_000889093.1.93126 WP_000889093.1.93129 WP_000889093.1.93135 WP_000889093.1.93152 WP_000889093.1.93154 WP_000889093.1.93158 WP_000889093.1.93173 WP_000889093.1.93178 WP_000889093.1.93183 WP_000889093.1.93202 WP_000889093.1.93210 WP_000889093.1.9326 WP_000889093.1.93262 WP_000889093.1.93274 WP_000889093.1.93279 WP_000889093.1.93281 WP_000889093.1.93285 WP_000889093.1.93311 WP_000889093.1.93314 WP_000889093.1.9332 WP_000889093.1.93347 WP_000889093.1.93361 WP_000889093.1.9339 WP_000889093.1.93398 WP_000889093.1.93401 WP_000889093.1.93404 WP_000889093.1.93442 WP_000889093.1.93452 WP_000889093.1.9347 WP_000889093.1.93474 WP_000889093.1.93475 WP_000889093.1.93479 WP_000889093.1.9348 WP_000889093.1.93496 WP_000889093.1.935 WP_000889093.1.93506 WP_000889093.1.93515 WP_000889093.1.93548 WP_000889093.1.93550 WP_000889093.1.93595 WP_000889093.1.93606 WP_000889093.1.93609 WP_000889093.1.93616 WP_000889093.1.9364 WP_000889093.1.93641 WP_000889093.1.93680 WP_000889093.1.93700 WP_000889093.1.93701 WP_000889093.1.93703 WP_000889093.1.93720 WP_000889093.1.93773 WP_000889093.1.93785 WP_000889093.1.93805 WP_000889093.1.93811 WP_000889093.1.93814 WP_000889093.1.93832 WP_000889093.1.93835 WP_000889093.1.93865 WP_000889093.1.93869 WP_000889093.1.93878 WP_000889093.1.93906 WP_000889093.1.93910 WP_000889093.1.93947 WP_000889093.1.93974 WP_000889093.1.93992 WP_000889093.1.94024 WP_000889093.1.94029 WP_000889093.1.94061 WP_000889093.1.94090 WP_000889093.1.94092 WP_000889093.1.94101 WP_000889093.1.94104 WP_000889093.1.94105 WP_000889093.1.9414 WP_000889093.1.94145 WP_000889093.1.94148 WP_000889093.1.94157 WP_000889093.1.94159 WP_000889093.1.94170 WP_000889093.1.94192 WP_000889093.1.94195 WP_000889093.1.94220 WP_000889093.1.94247 WP_000889093.1.94258 WP_000889093.1.94260 WP_000889093.1.94269 WP_000889093.1.94272 WP_000889093.1.94274 WP_000889093.1.94279 WP_000889093.1.9429 WP_000889093.1.943 WP_000889093.1.94316 WP_000889093.1.94330 WP_000889093.1.94334 WP_000889093.1.94357 WP_000889093.1.94368 WP_000889093.1.94369 WP_000889093.1.94391 WP_000889093.1.94395 WP_000889093.1.94425 WP_000889093.1.94442 WP_000889093.1.94444 WP_000889093.1.94459 WP_000889093.1.94466 WP_000889093.1.94469 WP_000889093.1.945 WP_000889093.1.94503 WP_000889093.1.94509 WP_000889093.1.94515 WP_000889093.1.9452 WP_000889093.1.94526 WP_000889093.1.94558 WP_000889093.1.94559 WP_000889093.1.94570 WP_000889093.1.94577 WP_000889093.1.9458 WP_000889093.1.94595 WP_000889093.1.94604 WP_000889093.1.94610 WP_000889093.1.94644 WP_000889093.1.94651 WP_000889093.1.94652 WP_000889093.1.94689 WP_000889093.1.94708 WP_000889093.1.94711 WP_000889093.1.94724 WP_000889093.1.94771 WP_000889093.1.94778 WP_000889093.1.94811 WP_000889093.1.9483 WP_000889093.1.94876 WP_000889093.1.94883 WP_000889093.1.94925 WP_000889093.1.94940 WP_000889093.1.94954 WP_000889093.1.95013 WP_000889093.1.95041 WP_000889093.1.95050 WP_000889093.1.95058 WP_000889093.1.95059 WP_000889093.1.95069 WP_000889093.1.95073 WP_000889093.1.95098 WP_000889093.1.95104 WP_000889093.1.95106 WP_000889093.1.95125 WP_000889093.1.95128 WP_000889093.1.95145 WP_000889093.1.95153 WP_000889093.1.95177 WP_000889093.1.9518 WP_000889093.1.95192 WP_000889093.1.95208 WP_000889093.1.95209 WP_000889093.1.95219 WP_000889093.1.95240 WP_000889093.1.95251 WP_000889093.1.95258 WP_000889093.1.95264 WP_000889093.1.953 WP_000889093.1.95303 WP_000889093.1.95321 WP_000889093.1.95322 WP_000889093.1.95356 WP_000889093.1.95369 WP_000889093.1.95376 WP_000889093.1.95413 WP_000889093.1.95479 WP_000889093.1.9549 WP_000889093.1.95528 WP_000889093.1.95531 WP_000889093.1.95532 WP_000889093.1.95553 WP_000889093.1.95583 WP_000889093.1.95602 WP_000889093.1.95621 WP_000889093.1.95642 WP_000889093.1.95695 WP_000889093.1.95698 WP_000889093.1.95707 WP_000889093.1.95722 WP_000889093.1.95725 WP_000889093.1.95732 WP_000889093.1.95736 WP_000889093.1.95738 WP_000889093.1.95740 WP_000889093.1.95762 WP_000889093.1.95765 WP_000889093.1.95769 WP_000889093.1.95778 WP_000889093.1.95807 WP_000889093.1.95822 WP_000889093.1.95853 WP_000889093.1.95856 WP_000889093.1.95868 WP_000889093.1.95870 WP_000889093.1.95876 WP_000889093.1.95879 WP_000889093.1.95881 WP_000889093.1.95904 WP_000889093.1.9592 WP_000889093.1.95925 WP_000889093.1.95933 WP_000889093.1.95936 WP_000889093.1.95942 WP_000889093.1.95956 WP_000889093.1.95968 WP_000889093.1.95988 WP_000889093.1.95992 WP_000889093.1.95998 WP_000889093.1.96003 WP_000889093.1.96007 WP_000889093.1.96011 WP_000889093.1.96012 WP_000889093.1.96016 WP_000889093.1.96024 WP_000889093.1.96048 WP_000889093.1.96049 WP_000889093.1.96072 WP_000889093.1.96081 WP_000889093.1.96096 WP_000889093.1.96100 WP_000889093.1.96103 WP_000889093.1.96106 WP_000889093.1.96109 WP_000889093.1.9611 WP_000889093.1.96117 WP_000889093.1.9612 WP_000889093.1.96126 WP_000889093.1.96138 WP_000889093.1.9615 WP_000889093.1.96178 WP_000889093.1.96181 WP_000889093.1.96189 WP_000889093.1.96205 WP_000889093.1.9621 WP_000889093.1.96227 WP_000889093.1.96231 WP_000889093.1.96244 WP_000889093.1.96249 WP_000889093.1.96277 WP_000889093.1.96292 WP_000889093.1.96307 WP_000889093.1.96309 WP_000889093.1.9632 WP_000889093.1.96324 WP_000889093.1.96350 WP_000889093.1.96432 WP_000889093.1.96436 WP_000889093.1.96487 WP_000889093.1.96499 WP_000889093.1.96517 WP_000889093.1.96564 WP_000889093.1.96565 WP_000889093.1.96580 WP_000889093.1.96594 WP_000889093.1.96595 WP_000889093.1.966 WP_000889093.1.96601 WP_000889093.1.96619 WP_000889093.1.9662 WP_000889093.1.96636 WP_000889093.1.96652 WP_000889093.1.96694 WP_000889093.1.967 WP_000889093.1.96703 WP_000889093.1.96713 WP_000889093.1.96728 WP_000889093.1.96749 WP_000889093.1.96772 WP_000889093.1.96785 WP_000889093.1.96791 WP_000889093.1.96812 WP_000889093.1.96819 WP_000889093.1.96821 WP_000889093.1.96833 WP_000889093.1.96872 WP_000889093.1.96873 WP_000889093.1.96875 WP_000889093.1.96889 WP_000889093.1.96899 WP_000889093.1.96901 WP_000889093.1.96913 WP_000889093.1.96939 WP_000889093.1.96974 WP_000889093.1.96994 WP_000889093.1.97035 WP_000889093.1.97040 WP_000889093.1.97045 WP_000889093.1.97046 WP_000889093.1.9705 WP_000889093.1.97051 WP_000889093.1.97066 WP_000889093.1.97091 WP_000889093.1.971 WP_000889093.1.97158 WP_000889093.1.97159 WP_000889093.1.97162 WP_000889093.1.97182 WP_000889093.1.97187 WP_000889093.1.972 WP_000889093.1.97210 WP_000889093.1.97252 WP_000889093.1.97265 WP_000889093.1.9727 WP_000889093.1.9730 WP_000889093.1.97354 WP_000889093.1.97381 WP_000889093.1.97383 WP_000889093.1.97410 WP_000889093.1.97436 WP_000889093.1.97476 WP_000889093.1.97482 WP_000889093.1.97485 WP_000889093.1.9750 WP_000889093.1.97524 WP_000889093.1.97526 WP_000889093.1.97543 WP_000889093.1.97553 WP_000889093.1.97556 WP_000889093.1.9757 WP_000889093.1.97582 WP_000889093.1.97595 WP_000889093.1.9760 WP_000889093.1.97610 WP_000889093.1.97644 WP_000889093.1.97657 WP_000889093.1.97686 WP_000889093.1.97702 WP_000889093.1.97733 WP_000889093.1.9778 WP_000889093.1.97804 WP_000889093.1.97808 WP_000889093.1.97810 WP_000889093.1.97856 WP_000889093.1.97859 WP_000889093.1.97862 WP_000889093.1.97866 WP_000889093.1.97875 WP_000889093.1.97876 WP_000889093.1.97878 WP_000889093.1.97880 WP_000889093.1.97886 WP_000889093.1.97891 WP_000889093.1.97892 WP_000889093.1.97921 WP_000889093.1.97925 WP_000889093.1.97931 WP_000889093.1.97980 WP_000889093.1.97994 WP_000889093.1.97998 WP_000889093.1.98050 WP_000889093.1.98057 WP_000889093.1.9806 WP_000889093.1.98074 WP_000889093.1.98084 WP_000889093.1.98094 WP_000889093.1.98103 WP_000889093.1.9812 WP_000889093.1.98159 WP_000889093.1.98168 WP_000889093.1.98182 WP_000889093.1.9819 WP_000889093.1.98196 WP_000889093.1.98198 WP_000889093.1.98217 WP_000889093.1.98234 WP_000889093.1.98245 WP_000889093.1.98259 WP_000889093.1.98270 WP_000889093.1.98273 WP_000889093.1.98277 WP_000889093.1.98286 WP_000889093.1.98288 WP_000889093.1.98290 WP_000889093.1.983 WP_000889093.1.98319 WP_000889093.1.98376 WP_000889093.1.98388 WP_000889093.1.98398 WP_000889093.1.98399 WP_000889093.1.98427 WP_000889093.1.98428 WP_000889093.1.98435 WP_000889093.1.98460 WP_000889093.1.98461 WP_000889093.1.98467 WP_000889093.1.98475 WP_000889093.1.98504 WP_000889093.1.98518 WP_000889093.1.98545 WP_000889093.1.98589 WP_000889093.1.98623 WP_000889093.1.98632 WP_000889093.1.98635 WP_000889093.1.98647 WP_000889093.1.98648 WP_000889093.1.98679 WP_000889093.1.9868 WP_000889093.1.98711 WP_000889093.1.98714 WP_000889093.1.98732 WP_000889093.1.98747 WP_000889093.1.98755 WP_000889093.1.98759 WP_000889093.1.98771 WP_000889093.1.98781 WP_000889093.1.98810 WP_000889093.1.98828 WP_000889093.1.98833 WP_000889093.1.98851 WP_000889093.1.98855 WP_000889093.1.98859 WP_000889093.1.98862 WP_000889093.1.98879 WP_000889093.1.98893 WP_000889093.1.98896 WP_000889093.1.98905 WP_000889093.1.98934 WP_000889093.1.98941 WP_000889093.1.98943 WP_000889093.1.9895 WP_000889093.1.98989 WP_000889093.1.98990 WP_000889093.1.99001 WP_000889093.1.99010 WP_000889093.1.99028 WP_000889093.1.99034 WP_000889093.1.99066 WP_000889093.1.99096 WP_000889093.1.99111 WP_000889093.1.99114 WP_000889093.1.99126 WP_000889093.1.99138 WP_000889093.1.99143 WP_000889093.1.99148 WP_000889093.1.99181 WP_000889093.1.99202 WP_000889093.1.99203 WP_000889093.1.99223 WP_000889093.1.9926 WP_000889093.1.99291 WP_000889093.1.99301 WP_000889093.1.99309 WP_000889093.1.9931 WP_000889093.1.99313 WP_000889093.1.99342 WP_000889093.1.99358 WP_000889093.1.99362 WP_000889093.1.99364 WP_000889093.1.99371 WP_000889093.1.99382 WP_000889093.1.99387 WP_000889093.1.99436 WP_000889093.1.99451 WP_000889093.1.99478 WP_000889093.1.99547 WP_000889093.1.99557 WP_000889093.1.99565 WP_000889093.1.99574 WP_000889093.1.99593 WP_000889093.1.99600 WP_000889093.1.99606 WP_000889093.1.99611 WP_000889093.1.99623 WP_000889093.1.99624 WP_000889093.1.99628 WP_000889093.1.99649 WP_000889093.1.99669 WP_000889093.1.99678 WP_000889093.1.99680 WP_000889093.1.99685 WP_000889093.1.99687 WP_000889093.1.9969 WP_000889093.1.997 WP_000889093.1.99753 WP_000889093.1.99760 WP_000889093.1.9978 WP_000889093.1.99787 WP_000889093.1.99790 WP_000889093.1.99793 WP_000889093.1.99839 WP_000889093.1.9984 WP_000889093.1.99853 WP_000889093.1.99879 WP_000889093.1.999 WP_000889093.1.99900 gi|387757723|ref|YP_006064702.1| gi|182684419|ref|YP_001836166.1| gi|225857088|ref|YP_002738599.1| gi|410476842|ref|YP_006743601.1| gi|194397502|ref|YP_002038095.1| gi|225859223|ref|YP_002740733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]