SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225857125|ref|YP_002738636.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225857125|ref|YP_002738636.1|
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.38e-26
Family Thioltransferase 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225857125|ref|YP_002738636.1|
Sequence length 115
Comment bacterocin transport accessory protein [Streptococcus pneumoniae P1031]
Sequence
MEQFLDNIKDLEVTTVVRAQEALDKKETATFFIGRKTCPYCRKFSGTLSGVVAETKAHIY
FINSEEPSQLNDLQAFRSRYGIPTVPGFVHITDGQINVRCDSSMSAQEIKDFAGL
Download sequence
Identical sequences A0A0D6J7I5 M5MWP7
gi|225857125|ref|YP_002738636.1| WP_000434652.1.10016 WP_000434652.1.101062 WP_000434652.1.101181 WP_000434652.1.10169 WP_000434652.1.101806 WP_000434652.1.1192 WP_000434652.1.12651 WP_000434652.1.12958 WP_000434652.1.13560 WP_000434652.1.1368 WP_000434652.1.13705 WP_000434652.1.14218 WP_000434652.1.15106 WP_000434652.1.15149 WP_000434652.1.15650 WP_000434652.1.16218 WP_000434652.1.17677 WP_000434652.1.17826 WP_000434652.1.1783 WP_000434652.1.17854 WP_000434652.1.19218 WP_000434652.1.2017 WP_000434652.1.21370 WP_000434652.1.21433 WP_000434652.1.21612 WP_000434652.1.21998 WP_000434652.1.22043 WP_000434652.1.22723 WP_000434652.1.23097 WP_000434652.1.23791 WP_000434652.1.23889 WP_000434652.1.24060 WP_000434652.1.24627 WP_000434652.1.24910 WP_000434652.1.25383 WP_000434652.1.25785 WP_000434652.1.26218 WP_000434652.1.27324 WP_000434652.1.27347 WP_000434652.1.27636 WP_000434652.1.2791 WP_000434652.1.29269 WP_000434652.1.29357 WP_000434652.1.29712 WP_000434652.1.30295 WP_000434652.1.30612 WP_000434652.1.30672 WP_000434652.1.3191 WP_000434652.1.31979 WP_000434652.1.35392 WP_000434652.1.35702 WP_000434652.1.36242 WP_000434652.1.37118 WP_000434652.1.37166 WP_000434652.1.39006 WP_000434652.1.39087 WP_000434652.1.39097 WP_000434652.1.395 WP_000434652.1.39710 WP_000434652.1.39931 WP_000434652.1.39985 WP_000434652.1.40682 WP_000434652.1.4094 WP_000434652.1.43634 WP_000434652.1.43900 WP_000434652.1.45006 WP_000434652.1.45601 WP_000434652.1.45753 WP_000434652.1.47043 WP_000434652.1.47394 WP_000434652.1.49025 WP_000434652.1.49635 WP_000434652.1.50005 WP_000434652.1.50621 WP_000434652.1.51096 WP_000434652.1.51626 WP_000434652.1.51855 WP_000434652.1.52957 WP_000434652.1.53042 WP_000434652.1.53440 WP_000434652.1.53950 WP_000434652.1.5396 WP_000434652.1.543 WP_000434652.1.54529 WP_000434652.1.54576 WP_000434652.1.55523 WP_000434652.1.55584 WP_000434652.1.56257 WP_000434652.1.58034 WP_000434652.1.58268 WP_000434652.1.58402 WP_000434652.1.58854 WP_000434652.1.59198 WP_000434652.1.59883 WP_000434652.1.59906 WP_000434652.1.60529 WP_000434652.1.60541 WP_000434652.1.60961 WP_000434652.1.62390 WP_000434652.1.62862 WP_000434652.1.63245 WP_000434652.1.63468 WP_000434652.1.63621 WP_000434652.1.63938 WP_000434652.1.6414 WP_000434652.1.64913 WP_000434652.1.64917 WP_000434652.1.65235 WP_000434652.1.65352 WP_000434652.1.65368 WP_000434652.1.65607 WP_000434652.1.66586 WP_000434652.1.67196 WP_000434652.1.67930 WP_000434652.1.68622 WP_000434652.1.69137 WP_000434652.1.69671 WP_000434652.1.69863 WP_000434652.1.69954 WP_000434652.1.71879 WP_000434652.1.72309 WP_000434652.1.72705 WP_000434652.1.73593 WP_000434652.1.73851 WP_000434652.1.75314 WP_000434652.1.76202 WP_000434652.1.76393 WP_000434652.1.78129 WP_000434652.1.78455 WP_000434652.1.78755 WP_000434652.1.78887 WP_000434652.1.7915 WP_000434652.1.79338 WP_000434652.1.7998 WP_000434652.1.80914 WP_000434652.1.81292 WP_000434652.1.815 WP_000434652.1.82051 WP_000434652.1.82666 WP_000434652.1.8360 WP_000434652.1.83606 WP_000434652.1.83796 WP_000434652.1.83922 WP_000434652.1.84513 WP_000434652.1.8506 WP_000434652.1.85062 WP_000434652.1.86320 WP_000434652.1.87421 WP_000434652.1.87731 WP_000434652.1.8799 WP_000434652.1.89094 WP_000434652.1.89294 WP_000434652.1.89652 WP_000434652.1.89763 WP_000434652.1.90501 WP_000434652.1.90577 WP_000434652.1.90778 WP_000434652.1.91024 WP_000434652.1.9332 WP_000434652.1.94247 WP_000434652.1.94515 WP_000434652.1.95219 WP_000434652.1.95936 WP_000434652.1.96231 WP_000434652.1.97582 WP_000434652.1.97866 WP_000434652.1.98277 WP_000434652.1.99181 WP_000434652.1.99685 WP_000434652.1.99687 gi|410476876|ref|YP_006743635.1| 488223.SPP_1519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]