SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225857178|ref|YP_002738689.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225857178|ref|YP_002738689.1|
Domain Number 1 Region: 131-257
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0055
Further Details:      
 
Domain Number 2 Region: 41-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.68e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225857178|ref|YP_002738689.1|
Sequence length 263
Comment putative glutathione S-transferase YghU [Streptococcus pneumoniae P1031]
Sequence
MSAYQLPTVWQDEASNQGAFTGLNRPTAGARFEQNLPKGEQAFQLYSLGTPNGVKVTILL
EELLEAGFKEAAYDLYKIAIMDGDQFGSDFVKLNPNSKIPALLDQSGTENVRVFESAHIL
LYLAEKFGAFLPSNPVEKVEVLNWLFWQAGAAPFLGGGFGHFFNYAPEKLEYPINRFTME
VKRQLDLLDKELAQKPYIAGNDYTIADIAIWSWYGQLVQGNLYQGSAKFLDASSYQNLVK
WAEKIANRPAVKRGLEVTYTEIK
Download sequence
Identical sequences A0A062WTP1 A0A0H2UQV0 A0A158LJK7 A5LL36 D6ZMA2 G6LNW3 M5JW35 M5KL60 M5MYA1
170187.SP_1550 487213.SPT_1492 488223.SPP_1575 512566.SPG_1478 gi|225857178|ref|YP_002738689.1| gi|387626775|ref|YP_006062951.1| gi|307068195|ref|YP_003877161.1| gi|15901393|ref|NP_345997.1| gi|387788609|ref|YP_006253677.1| gi|410476929|ref|YP_006743688.1| gi|556561310|ref|YP_008730667.1| WP_001277403.1.100001 WP_001277403.1.100012 WP_001277403.1.100026 WP_001277403.1.100033 WP_001277403.1.100054 WP_001277403.1.10009 WP_001277403.1.100102 WP_001277403.1.100110 WP_001277403.1.100192 WP_001277403.1.100203 WP_001277403.1.100341 WP_001277403.1.100353 WP_001277403.1.100364 WP_001277403.1.100397 WP_001277403.1.100483 WP_001277403.1.100492 WP_001277403.1.100529 WP_001277403.1.100532 WP_001277403.1.100540 WP_001277403.1.100572 WP_001277403.1.100579 WP_001277403.1.10060 WP_001277403.1.100640 WP_001277403.1.100681 WP_001277403.1.100715 WP_001277403.1.100734 WP_001277403.1.100816 WP_001277403.1.100818 WP_001277403.1.100829 WP_001277403.1.100855 WP_001277403.1.100863 WP_001277403.1.100874 WP_001277403.1.100892 WP_001277403.1.100911 WP_001277403.1.100914 WP_001277403.1.100937 WP_001277403.1.10103 WP_001277403.1.101045 WP_001277403.1.101080 WP_001277403.1.101135 WP_001277403.1.101178 WP_001277403.1.10118 WP_001277403.1.101213 WP_001277403.1.10122 WP_001277403.1.10123 WP_001277403.1.101232 WP_001277403.1.101241 WP_001277403.1.101250 WP_001277403.1.101256 WP_001277403.1.101274 WP_001277403.1.101286 WP_001277403.1.101287 WP_001277403.1.101315 WP_001277403.1.101369 WP_001277403.1.101407 WP_001277403.1.101435 WP_001277403.1.101457 WP_001277403.1.101482 WP_001277403.1.101483 WP_001277403.1.101484 WP_001277403.1.101494 WP_001277403.1.101500 WP_001277403.1.101517 WP_001277403.1.101537 WP_001277403.1.101560 WP_001277403.1.101577 WP_001277403.1.101599 WP_001277403.1.101649 WP_001277403.1.101689 WP_001277403.1.10169 WP_001277403.1.1017 WP_001277403.1.101709 WP_001277403.1.101738 WP_001277403.1.101760 WP_001277403.1.101765 WP_001277403.1.101790 WP_001277403.1.101806 WP_001277403.1.101842 WP_001277403.1.101847 WP_001277403.1.101876 WP_001277403.1.101891 WP_001277403.1.101912 WP_001277403.1.101946 WP_001277403.1.10196 WP_001277403.1.101961 WP_001277403.1.1020 WP_001277403.1.102004 WP_001277403.1.102077 WP_001277403.1.102091 WP_001277403.1.102129 WP_001277403.1.102134 WP_001277403.1.1026 WP_001277403.1.10295 WP_001277403.1.10314 WP_001277403.1.10316 WP_001277403.1.10337 WP_001277403.1.10364 WP_001277403.1.10391 WP_001277403.1.10437 WP_001277403.1.10449 WP_001277403.1.10499 WP_001277403.1.1050 WP_001277403.1.10571 WP_001277403.1.1059 WP_001277403.1.10613 WP_001277403.1.10622 WP_001277403.1.10692 WP_001277403.1.1070 WP_001277403.1.10708 WP_001277403.1.10807 WP_001277403.1.10820 WP_001277403.1.10828 WP_001277403.1.1083 WP_001277403.1.10910 WP_001277403.1.10914 WP_001277403.1.10934 WP_001277403.1.10948 WP_001277403.1.10952 WP_001277403.1.11 WP_001277403.1.11007 WP_001277403.1.11027 WP_001277403.1.11035 WP_001277403.1.11043 WP_001277403.1.11045 WP_001277403.1.11096 WP_001277403.1.11102 WP_001277403.1.11103 WP_001277403.1.11120 WP_001277403.1.11144 WP_001277403.1.11197 WP_001277403.1.11205 WP_001277403.1.11233 WP_001277403.1.11260 WP_001277403.1.11279 WP_001277403.1.11297 WP_001277403.1.1131 WP_001277403.1.11311 WP_001277403.1.11319 WP_001277403.1.11328 WP_001277403.1.11337 WP_001277403.1.11358 WP_001277403.1.11425 WP_001277403.1.11435 WP_001277403.1.11448 WP_001277403.1.11474 WP_001277403.1.11486 WP_001277403.1.11495 WP_001277403.1.11510 WP_001277403.1.11534 WP_001277403.1.11546 WP_001277403.1.11570 WP_001277403.1.11594 WP_001277403.1.11619 WP_001277403.1.11622 WP_001277403.1.11652 WP_001277403.1.11657 WP_001277403.1.11664 WP_001277403.1.11706 WP_001277403.1.11711 WP_001277403.1.11760 WP_001277403.1.11765 WP_001277403.1.1178 WP_001277403.1.11792 WP_001277403.1.11842 WP_001277403.1.11849 WP_001277403.1.11902 WP_001277403.1.1192 WP_001277403.1.11935 WP_001277403.1.11967 WP_001277403.1.1201 WP_001277403.1.12023 WP_001277403.1.12034 WP_001277403.1.12068 WP_001277403.1.12099 WP_001277403.1.12128 WP_001277403.1.12134 WP_001277403.1.12154 WP_001277403.1.12182 WP_001277403.1.1221 WP_001277403.1.12214 WP_001277403.1.12218 WP_001277403.1.12222 WP_001277403.1.12238 WP_001277403.1.12243 WP_001277403.1.12306 WP_001277403.1.12337 WP_001277403.1.12395 WP_001277403.1.124 WP_001277403.1.12404 WP_001277403.1.12407 WP_001277403.1.12413 WP_001277403.1.12428 WP_001277403.1.12430 WP_001277403.1.12440 WP_001277403.1.12444 WP_001277403.1.12450 WP_001277403.1.12470 WP_001277403.1.12487 WP_001277403.1.12489 WP_001277403.1.12492 WP_001277403.1.12578 WP_001277403.1.1258 WP_001277403.1.12580 WP_001277403.1.12583 WP_001277403.1.12588 WP_001277403.1.1262 WP_001277403.1.12651 WP_001277403.1.12673 WP_001277403.1.12681 WP_001277403.1.12723 WP_001277403.1.12729 WP_001277403.1.12786 WP_001277403.1.128 WP_001277403.1.12805 WP_001277403.1.12811 WP_001277403.1.12905 WP_001277403.1.12928 WP_001277403.1.12942 WP_001277403.1.12952 WP_001277403.1.12958 WP_001277403.1.12996 WP_001277403.1.13000 WP_001277403.1.1302 WP_001277403.1.1303 WP_001277403.1.13035 WP_001277403.1.13036 WP_001277403.1.13048 WP_001277403.1.13058 WP_001277403.1.13067 WP_001277403.1.13100 WP_001277403.1.13140 WP_001277403.1.13152 WP_001277403.1.13168 WP_001277403.1.13229 WP_001277403.1.13256 WP_001277403.1.13257 WP_001277403.1.1329 WP_001277403.1.1332 WP_001277403.1.13327 WP_001277403.1.13340 WP_001277403.1.13351 WP_001277403.1.13363 WP_001277403.1.13382 WP_001277403.1.13390 WP_001277403.1.13402 WP_001277403.1.13410 WP_001277403.1.13455 WP_001277403.1.135 WP_001277403.1.13515 WP_001277403.1.13570 WP_001277403.1.13581 WP_001277403.1.13590 WP_001277403.1.13606 WP_001277403.1.13629 WP_001277403.1.13653 WP_001277403.1.1367 WP_001277403.1.1368 WP_001277403.1.13692 WP_001277403.1.13705 WP_001277403.1.1371 WP_001277403.1.13729 WP_001277403.1.13830 WP_001277403.1.13839 WP_001277403.1.13854 WP_001277403.1.13873 WP_001277403.1.13903 WP_001277403.1.1391 WP_001277403.1.13954 WP_001277403.1.13958 WP_001277403.1.13960 WP_001277403.1.13989 WP_001277403.1.1399 WP_001277403.1.13990 WP_001277403.1.13997 WP_001277403.1.14002 WP_001277403.1.14033 WP_001277403.1.14066 WP_001277403.1.14077 WP_001277403.1.14106 WP_001277403.1.14183 WP_001277403.1.14206 WP_001277403.1.14211 WP_001277403.1.14217 WP_001277403.1.14218 WP_001277403.1.14258 WP_001277403.1.14260 WP_001277403.1.14287 WP_001277403.1.14291 WP_001277403.1.14295 WP_001277403.1.1432 WP_001277403.1.14335 WP_001277403.1.14347 WP_001277403.1.14384 WP_001277403.1.14408 WP_001277403.1.14430 WP_001277403.1.14435 WP_001277403.1.14440 WP_001277403.1.1449 WP_001277403.1.14511 WP_001277403.1.14513 WP_001277403.1.14534 WP_001277403.1.14558 WP_001277403.1.14560 WP_001277403.1.14578 WP_001277403.1.14622 WP_001277403.1.14663 WP_001277403.1.14682 WP_001277403.1.14722 WP_001277403.1.14740 WP_001277403.1.14745 WP_001277403.1.14779 WP_001277403.1.14780 WP_001277403.1.14784 WP_001277403.1.14880 WP_001277403.1.14892 WP_001277403.1.14907 WP_001277403.1.14949 WP_001277403.1.14957 WP_001277403.1.14959 WP_001277403.1.14975 WP_001277403.1.14983 WP_001277403.1.15018 WP_001277403.1.15024 WP_001277403.1.15030 WP_001277403.1.15045 WP_001277403.1.15104 WP_001277403.1.15135 WP_001277403.1.15141 WP_001277403.1.15155 WP_001277403.1.15162 WP_001277403.1.1522 WP_001277403.1.15220 WP_001277403.1.15266 WP_001277403.1.15305 WP_001277403.1.15366 WP_001277403.1.15370 WP_001277403.1.15390 WP_001277403.1.15395 WP_001277403.1.1541 WP_001277403.1.15504 WP_001277403.1.15513 WP_001277403.1.15523 WP_001277403.1.15575 WP_001277403.1.15578 WP_001277403.1.15588 WP_001277403.1.15596 WP_001277403.1.15635 WP_001277403.1.15648 WP_001277403.1.15650 WP_001277403.1.1566 WP_001277403.1.15670 WP_001277403.1.15683 WP_001277403.1.15720 WP_001277403.1.15759 WP_001277403.1.15761 WP_001277403.1.15787 WP_001277403.1.15788 WP_001277403.1.15797 WP_001277403.1.15800 WP_001277403.1.1584 WP_001277403.1.15841 WP_001277403.1.15854 WP_001277403.1.15872 WP_001277403.1.15900 WP_001277403.1.15943 WP_001277403.1.15965 WP_001277403.1.16053 WP_001277403.1.16064 WP_001277403.1.16081 WP_001277403.1.16093 WP_001277403.1.16099 WP_001277403.1.16145 WP_001277403.1.16181 WP_001277403.1.16184 WP_001277403.1.16220 WP_001277403.1.16240 WP_001277403.1.16282 WP_001277403.1.16287 WP_001277403.1.16302 WP_001277403.1.16317 WP_001277403.1.16330 WP_001277403.1.16337 WP_001277403.1.16375 WP_001277403.1.16379 WP_001277403.1.16385 WP_001277403.1.16404 WP_001277403.1.16441 WP_001277403.1.16470 WP_001277403.1.16521 WP_001277403.1.16527 WP_001277403.1.16543 WP_001277403.1.16568 WP_001277403.1.16570 WP_001277403.1.16575 WP_001277403.1.16676 WP_001277403.1.16730 WP_001277403.1.16778 WP_001277403.1.16803 WP_001277403.1.1682 WP_001277403.1.16832 WP_001277403.1.1684 WP_001277403.1.16849 WP_001277403.1.1686 WP_001277403.1.16884 WP_001277403.1.16904 WP_001277403.1.16911 WP_001277403.1.16947 WP_001277403.1.17029 WP_001277403.1.17033 WP_001277403.1.17063 WP_001277403.1.1711 WP_001277403.1.17178 WP_001277403.1.17220 WP_001277403.1.17227 WP_001277403.1.17238 WP_001277403.1.17252 WP_001277403.1.17257 WP_001277403.1.17263 WP_001277403.1.17269 WP_001277403.1.17312 WP_001277403.1.17315 WP_001277403.1.17330 WP_001277403.1.17355 WP_001277403.1.17411 WP_001277403.1.17420 WP_001277403.1.17438 WP_001277403.1.17474 WP_001277403.1.17537 WP_001277403.1.17609 WP_001277403.1.17639 WP_001277403.1.17652 WP_001277403.1.17672 WP_001277403.1.17677 WP_001277403.1.17690 WP_001277403.1.17692 WP_001277403.1.17706 WP_001277403.1.17715 WP_001277403.1.17716 WP_001277403.1.17775 WP_001277403.1.17776 WP_001277403.1.17810 WP_001277403.1.1783 WP_001277403.1.17839 WP_001277403.1.17844 WP_001277403.1.17858 WP_001277403.1.17933 WP_001277403.1.17942 WP_001277403.1.17954 WP_001277403.1.17971 WP_001277403.1.18040 WP_001277403.1.18067 WP_001277403.1.18081 WP_001277403.1.18130 WP_001277403.1.18131 WP_001277403.1.18215 WP_001277403.1.18230 WP_001277403.1.18233 WP_001277403.1.18236 WP_001277403.1.18244 WP_001277403.1.18266 WP_001277403.1.18276 WP_001277403.1.18278 WP_001277403.1.18279 WP_001277403.1.18361 WP_001277403.1.1839 WP_001277403.1.18404 WP_001277403.1.18457 WP_001277403.1.1846 WP_001277403.1.18481 WP_001277403.1.18488 WP_001277403.1.18514 WP_001277403.1.18521 WP_001277403.1.18528 WP_001277403.1.18534 WP_001277403.1.18555 WP_001277403.1.18571 WP_001277403.1.18572 WP_001277403.1.18630 WP_001277403.1.18638 WP_001277403.1.18652 WP_001277403.1.18670 WP_001277403.1.18687 WP_001277403.1.18712 WP_001277403.1.1872 WP_001277403.1.18733 WP_001277403.1.18768 WP_001277403.1.18771 WP_001277403.1.18869 WP_001277403.1.1887 WP_001277403.1.18884 WP_001277403.1.18920 WP_001277403.1.18951 WP_001277403.1.1899 WP_001277403.1.19000 WP_001277403.1.19015 WP_001277403.1.1902 WP_001277403.1.19060 WP_001277403.1.19104 WP_001277403.1.19127 WP_001277403.1.19162 WP_001277403.1.19172 WP_001277403.1.19236 WP_001277403.1.19237 WP_001277403.1.19239 WP_001277403.1.19267 WP_001277403.1.19359 WP_001277403.1.19368 WP_001277403.1.19413 WP_001277403.1.19420 WP_001277403.1.19467 WP_001277403.1.19470 WP_001277403.1.19489 WP_001277403.1.19510 WP_001277403.1.19527 WP_001277403.1.19530 WP_001277403.1.19532 WP_001277403.1.19558 WP_001277403.1.1956 WP_001277403.1.19603 WP_001277403.1.19631 WP_001277403.1.19633 WP_001277403.1.19698 WP_001277403.1.19719 WP_001277403.1.19754 WP_001277403.1.1983 WP_001277403.1.19837 WP_001277403.1.1985 WP_001277403.1.19942 WP_001277403.1.19961 WP_001277403.1.19965 WP_001277403.1.19983 WP_001277403.1.19998 WP_001277403.1.20008 WP_001277403.1.20015 WP_001277403.1.20041 WP_001277403.1.20079 WP_001277403.1.20108 WP_001277403.1.20128 WP_001277403.1.2019 WP_001277403.1.20207 WP_001277403.1.20209 WP_001277403.1.20274 WP_001277403.1.20281 WP_001277403.1.20298 WP_001277403.1.203 WP_001277403.1.20312 WP_001277403.1.20328 WP_001277403.1.20382 WP_001277403.1.20385 WP_001277403.1.20396 WP_001277403.1.20408 WP_001277403.1.20421 WP_001277403.1.20486 WP_001277403.1.20491 WP_001277403.1.20509 WP_001277403.1.2060 WP_001277403.1.20671 WP_001277403.1.20693 WP_001277403.1.207 WP_001277403.1.20702 WP_001277403.1.20712 WP_001277403.1.20719 WP_001277403.1.20782 WP_001277403.1.20805 WP_001277403.1.20858 WP_001277403.1.20892 WP_001277403.1.20899 WP_001277403.1.20909 WP_001277403.1.20915 WP_001277403.1.20965 WP_001277403.1.20984 WP_001277403.1.20996 WP_001277403.1.21028 WP_001277403.1.21095 WP_001277403.1.21174 WP_001277403.1.21176 WP_001277403.1.21192 WP_001277403.1.21216 WP_001277403.1.21230 WP_001277403.1.21233 WP_001277403.1.21271 WP_001277403.1.213 WP_001277403.1.21370 WP_001277403.1.21377 WP_001277403.1.21381 WP_001277403.1.21422 WP_001277403.1.21445 WP_001277403.1.21472 WP_001277403.1.21503 WP_001277403.1.21507 WP_001277403.1.2152 WP_001277403.1.21599 WP_001277403.1.21604 WP_001277403.1.21605 WP_001277403.1.21610 WP_001277403.1.21642 WP_001277403.1.2167 WP_001277403.1.21682 WP_001277403.1.21684 WP_001277403.1.21691 WP_001277403.1.21699 WP_001277403.1.21701 WP_001277403.1.2173 WP_001277403.1.21735 WP_001277403.1.21781 WP_001277403.1.21790 WP_001277403.1.2180 WP_001277403.1.21806 WP_001277403.1.21816 WP_001277403.1.21824 WP_001277403.1.21949 WP_001277403.1.2197 WP_001277403.1.21979 WP_001277403.1.21990 WP_001277403.1.21998 WP_001277403.1.22014 WP_001277403.1.22035 WP_001277403.1.22048 WP_001277403.1.22058 WP_001277403.1.22083 WP_001277403.1.22121 WP_001277403.1.22124 WP_001277403.1.22135 WP_001277403.1.22179 WP_001277403.1.22196 WP_001277403.1.22263 WP_001277403.1.22271 WP_001277403.1.22297 WP_001277403.1.22341 WP_001277403.1.22392 WP_001277403.1.22397 WP_001277403.1.22422 WP_001277403.1.22439 WP_001277403.1.22459 WP_001277403.1.22480 WP_001277403.1.22503 WP_001277403.1.22505 WP_001277403.1.22506 WP_001277403.1.22513 WP_001277403.1.22550 WP_001277403.1.22554 WP_001277403.1.22556 WP_001277403.1.22561 WP_001277403.1.22563 WP_001277403.1.22591 WP_001277403.1.22612 WP_001277403.1.2263 WP_001277403.1.22636 WP_001277403.1.22638 WP_001277403.1.22640 WP_001277403.1.22643 WP_001277403.1.22655 WP_001277403.1.22675 WP_001277403.1.22677 WP_001277403.1.22711 WP_001277403.1.22720 WP_001277403.1.22723 WP_001277403.1.22753 WP_001277403.1.22772 WP_001277403.1.22791 WP_001277403.1.22839 WP_001277403.1.22938 WP_001277403.1.2295 WP_001277403.1.22955 WP_001277403.1.2296 WP_001277403.1.2297 WP_001277403.1.23018 WP_001277403.1.23025 WP_001277403.1.23028 WP_001277403.1.23039 WP_001277403.1.23077 WP_001277403.1.2310 WP_001277403.1.2311 WP_001277403.1.23111 WP_001277403.1.23138 WP_001277403.1.23177 WP_001277403.1.23178 WP_001277403.1.23180 WP_001277403.1.23256 WP_001277403.1.23276 WP_001277403.1.23313 WP_001277403.1.23320 WP_001277403.1.23334 WP_001277403.1.23354 WP_001277403.1.23432 WP_001277403.1.23481 WP_001277403.1.23536 WP_001277403.1.23597 WP_001277403.1.23600 WP_001277403.1.23606 WP_001277403.1.23696 WP_001277403.1.23713 WP_001277403.1.23770 WP_001277403.1.23791 WP_001277403.1.23798 WP_001277403.1.23800 WP_001277403.1.23889 WP_001277403.1.23912 WP_001277403.1.23916 WP_001277403.1.23966 WP_001277403.1.23991 WP_001277403.1.24067 WP_001277403.1.24085 WP_001277403.1.24094 WP_001277403.1.24098 WP_001277403.1.24102 WP_001277403.1.24116 WP_001277403.1.24164 WP_001277403.1.24218 WP_001277403.1.24220 WP_001277403.1.24222 WP_001277403.1.24232 WP_001277403.1.24247 WP_001277403.1.24252 WP_001277403.1.24281 WP_001277403.1.24288 WP_001277403.1.2429 WP_001277403.1.243 WP_001277403.1.24318 WP_001277403.1.24324 WP_001277403.1.24356 WP_001277403.1.24379 WP_001277403.1.24384 WP_001277403.1.24440 WP_001277403.1.24467 WP_001277403.1.24481 WP_001277403.1.24501 WP_001277403.1.24540 WP_001277403.1.24552 WP_001277403.1.24562 WP_001277403.1.24574 WP_001277403.1.2461 WP_001277403.1.24610 WP_001277403.1.24620 WP_001277403.1.24627 WP_001277403.1.2465 WP_001277403.1.24653 WP_001277403.1.24677 WP_001277403.1.24724 WP_001277403.1.24772 WP_001277403.1.24844 WP_001277403.1.24861 WP_001277403.1.24871 WP_001277403.1.24874 WP_001277403.1.249 WP_001277403.1.24928 WP_001277403.1.24943 WP_001277403.1.24970 WP_001277403.1.24993 WP_001277403.1.25005 WP_001277403.1.2503 WP_001277403.1.25084 WP_001277403.1.25106 WP_001277403.1.25121 WP_001277403.1.252 WP_001277403.1.25202 WP_001277403.1.25222 WP_001277403.1.25228 WP_001277403.1.25244 WP_001277403.1.25298 WP_001277403.1.2533 WP_001277403.1.25337 WP_001277403.1.25340 WP_001277403.1.25351 WP_001277403.1.25366 WP_001277403.1.2538 WP_001277403.1.25383 WP_001277403.1.25424 WP_001277403.1.25432 WP_001277403.1.2548 WP_001277403.1.25494 WP_001277403.1.25502 WP_001277403.1.25507 WP_001277403.1.2553 WP_001277403.1.25538 WP_001277403.1.2556 WP_001277403.1.25571 WP_001277403.1.25624 WP_001277403.1.25660 WP_001277403.1.25662 WP_001277403.1.25685 WP_001277403.1.25696 WP_001277403.1.25754 WP_001277403.1.25768 WP_001277403.1.25771 WP_001277403.1.25791 WP_001277403.1.25792 WP_001277403.1.2586 WP_001277403.1.25875 WP_001277403.1.25880 WP_001277403.1.25888 WP_001277403.1.25905 WP_001277403.1.25909 WP_001277403.1.25958 WP_001277403.1.25966 WP_001277403.1.25982 WP_001277403.1.25986 WP_001277403.1.25994 WP_001277403.1.26041 WP_001277403.1.26062 WP_001277403.1.2607 WP_001277403.1.26078 WP_001277403.1.26085 WP_001277403.1.2610 WP_001277403.1.26111 WP_001277403.1.26112 WP_001277403.1.26180 WP_001277403.1.26218 WP_001277403.1.26220 WP_001277403.1.26257 WP_001277403.1.26279 WP_001277403.1.2629 WP_001277403.1.26317 WP_001277403.1.26344 WP_001277403.1.26389 WP_001277403.1.26392 WP_001277403.1.26447 WP_001277403.1.2647 WP_001277403.1.26484 WP_001277403.1.26490 WP_001277403.1.26497 WP_001277403.1.26653 WP_001277403.1.26725 WP_001277403.1.26743 WP_001277403.1.26755 WP_001277403.1.26781 WP_001277403.1.26783 WP_001277403.1.26785 WP_001277403.1.26793 WP_001277403.1.26799 WP_001277403.1.26807 WP_001277403.1.26848 WP_001277403.1.26855 WP_001277403.1.26858 WP_001277403.1.26875 WP_001277403.1.26877 WP_001277403.1.26900 WP_001277403.1.26909 WP_001277403.1.26918 WP_001277403.1.26926 WP_001277403.1.26953 WP_001277403.1.26968 WP_001277403.1.26990 WP_001277403.1.26994 WP_001277403.1.27022 WP_001277403.1.2703 WP_001277403.1.27046 WP_001277403.1.27048 WP_001277403.1.27071 WP_001277403.1.27082 WP_001277403.1.27119 WP_001277403.1.27151 WP_001277403.1.27174 WP_001277403.1.27203 WP_001277403.1.27219 WP_001277403.1.27252 WP_001277403.1.27267 WP_001277403.1.2729 WP_001277403.1.27308 WP_001277403.1.27315 WP_001277403.1.27324 WP_001277403.1.2735 WP_001277403.1.27362 WP_001277403.1.27382 WP_001277403.1.27405 WP_001277403.1.27421 WP_001277403.1.27432 WP_001277403.1.27479 WP_001277403.1.2750 WP_001277403.1.27514 WP_001277403.1.2752 WP_001277403.1.27573 WP_001277403.1.27653 WP_001277403.1.27661 WP_001277403.1.27684 WP_001277403.1.27721 WP_001277403.1.27740 WP_001277403.1.27746 WP_001277403.1.27759 WP_001277403.1.27768 WP_001277403.1.27789 WP_001277403.1.27808 WP_001277403.1.27865 WP_001277403.1.27868 WP_001277403.1.27907 WP_001277403.1.27964 WP_001277403.1.27970 WP_001277403.1.27984 WP_001277403.1.27988 WP_001277403.1.280 WP_001277403.1.28014 WP_001277403.1.28028 WP_001277403.1.28050 WP_001277403.1.28069 WP_001277403.1.28089 WP_001277403.1.28121 WP_001277403.1.28140 WP_001277403.1.28146 WP_001277403.1.28151 WP_001277403.1.28162 WP_001277403.1.28164 WP_001277403.1.28183 WP_001277403.1.28228 WP_001277403.1.28248 WP_001277403.1.28259 WP_001277403.1.2830 WP_001277403.1.28307 WP_001277403.1.28353 WP_001277403.1.28408 WP_001277403.1.28458 WP_001277403.1.28460 WP_001277403.1.28524 WP_001277403.1.28537 WP_001277403.1.28542 WP_001277403.1.28549 WP_001277403.1.2857 WP_001277403.1.28572 WP_001277403.1.28589 WP_001277403.1.2861 WP_001277403.1.28643 WP_001277403.1.2868 WP_001277403.1.28680 WP_001277403.1.28708 WP_001277403.1.28746 WP_001277403.1.28761 WP_001277403.1.28767 WP_001277403.1.28772 WP_001277403.1.28790 WP_001277403.1.2882 WP_001277403.1.28834 WP_001277403.1.28841 WP_001277403.1.28846 WP_001277403.1.28868 WP_001277403.1.28869 WP_001277403.1.2888 WP_001277403.1.28892 WP_001277403.1.28931 WP_001277403.1.28945 WP_001277403.1.28957 WP_001277403.1.28997 WP_001277403.1.29009 WP_001277403.1.2909 WP_001277403.1.29104 WP_001277403.1.29192 WP_001277403.1.292 WP_001277403.1.29205 WP_001277403.1.29210 WP_001277403.1.2922 WP_001277403.1.29232 WP_001277403.1.29249 WP_001277403.1.29253 WP_001277403.1.29266 WP_001277403.1.29269 WP_001277403.1.29284 WP_001277403.1.29300 WP_001277403.1.29311 WP_001277403.1.29317 WP_001277403.1.29360 WP_001277403.1.2940 WP_001277403.1.29469 WP_001277403.1.29473 WP_001277403.1.295 WP_001277403.1.2951 WP_001277403.1.29517 WP_001277403.1.29536 WP_001277403.1.29624 WP_001277403.1.29653 WP_001277403.1.29655 WP_001277403.1.2966 WP_001277403.1.29694 WP_001277403.1.2970 WP_001277403.1.29702 WP_001277403.1.29712 WP_001277403.1.29810 WP_001277403.1.29852 WP_001277403.1.29868 WP_001277403.1.29894 WP_001277403.1.29921 WP_001277403.1.29944 WP_001277403.1.29951 WP_001277403.1.30011 WP_001277403.1.30065 WP_001277403.1.30119 WP_001277403.1.30137 WP_001277403.1.30142 WP_001277403.1.30167 WP_001277403.1.30199 WP_001277403.1.30205 WP_001277403.1.30219 WP_001277403.1.30234 WP_001277403.1.30243 WP_001277403.1.30250 WP_001277403.1.30255 WP_001277403.1.30280 WP_001277403.1.30287 WP_001277403.1.30301 WP_001277403.1.30305 WP_001277403.1.30316 WP_001277403.1.30342 WP_001277403.1.30384 WP_001277403.1.30387 WP_001277403.1.3040 WP_001277403.1.30405 WP_001277403.1.30406 WP_001277403.1.30427 WP_001277403.1.30435 WP_001277403.1.30443 WP_001277403.1.30480 WP_001277403.1.30481 WP_001277403.1.30515 WP_001277403.1.30549 WP_001277403.1.30553 WP_001277403.1.30711 WP_001277403.1.30757 WP_001277403.1.30784 WP_001277403.1.30795 WP_001277403.1.3084 WP_001277403.1.3085 WP_001277403.1.30864 WP_001277403.1.30869 WP_001277403.1.30891 WP_001277403.1.30942 WP_001277403.1.30956 WP_001277403.1.30959 WP_001277403.1.30982 WP_001277403.1.30984 WP_001277403.1.31006 WP_001277403.1.31031 WP_001277403.1.3105 WP_001277403.1.31057 WP_001277403.1.3106 WP_001277403.1.31164 WP_001277403.1.31216 WP_001277403.1.31218 WP_001277403.1.31256 WP_001277403.1.3133 WP_001277403.1.31383 WP_001277403.1.31394 WP_001277403.1.31427 WP_001277403.1.31439 WP_001277403.1.31443 WP_001277403.1.31464 WP_001277403.1.31473 WP_001277403.1.3152 WP_001277403.1.31528 WP_001277403.1.31545 WP_001277403.1.3155 WP_001277403.1.31553 WP_001277403.1.3156 WP_001277403.1.31619 WP_001277403.1.31620 WP_001277403.1.31652 WP_001277403.1.31695 WP_001277403.1.31705 WP_001277403.1.31735 WP_001277403.1.31755 WP_001277403.1.31759 WP_001277403.1.31767 WP_001277403.1.31822 WP_001277403.1.31859 WP_001277403.1.31876 WP_001277403.1.31887 WP_001277403.1.3191 WP_001277403.1.31915 WP_001277403.1.31929 WP_001277403.1.31935 WP_001277403.1.31979 WP_001277403.1.31989 WP_001277403.1.31996 WP_001277403.1.320 WP_001277403.1.32032 WP_001277403.1.32079 WP_001277403.1.32083 WP_001277403.1.3211 WP_001277403.1.32171 WP_001277403.1.32186 WP_001277403.1.3221 WP_001277403.1.32246 WP_001277403.1.32280 WP_001277403.1.32282 WP_001277403.1.32296 WP_001277403.1.32313 WP_001277403.1.32389 WP_001277403.1.32391 WP_001277403.1.3241 WP_001277403.1.32413 WP_001277403.1.32419 WP_001277403.1.32439 WP_001277403.1.32462 WP_001277403.1.32485 WP_001277403.1.3255 WP_001277403.1.32567 WP_001277403.1.32606 WP_001277403.1.32642 WP_001277403.1.32644 WP_001277403.1.32696 WP_001277403.1.32719 WP_001277403.1.32734 WP_001277403.1.32768 WP_001277403.1.32771 WP_001277403.1.32774 WP_001277403.1.32807 WP_001277403.1.32808 WP_001277403.1.32820 WP_001277403.1.32877 WP_001277403.1.32892 WP_001277403.1.32924 WP_001277403.1.32949 WP_001277403.1.32950 WP_001277403.1.33013 WP_001277403.1.33021 WP_001277403.1.33070 WP_001277403.1.33071 WP_001277403.1.33073 WP_001277403.1.33080 WP_001277403.1.33091 WP_001277403.1.33100 WP_001277403.1.33128 WP_001277403.1.33135 WP_001277403.1.33159 WP_001277403.1.33166 WP_001277403.1.33180 WP_001277403.1.33181 WP_001277403.1.33188 WP_001277403.1.3319 WP_001277403.1.33259 WP_001277403.1.33312 WP_001277403.1.33348 WP_001277403.1.33354 WP_001277403.1.33361 WP_001277403.1.33415 WP_001277403.1.33430 WP_001277403.1.33433 WP_001277403.1.33436 WP_001277403.1.33437 WP_001277403.1.33458 WP_001277403.1.33482 WP_001277403.1.33527 WP_001277403.1.33528 WP_001277403.1.33570 WP_001277403.1.3359 WP_001277403.1.33598 WP_001277403.1.33606 WP_001277403.1.33637 WP_001277403.1.33647 WP_001277403.1.33674 WP_001277403.1.33709 WP_001277403.1.33719 WP_001277403.1.33727 WP_001277403.1.33749 WP_001277403.1.3375 WP_001277403.1.33791 WP_001277403.1.33808 WP_001277403.1.33815 WP_001277403.1.33878 WP_001277403.1.33882 WP_001277403.1.33891 WP_001277403.1.33897 WP_001277403.1.33933 WP_001277403.1.33950 WP_001277403.1.33960 WP_001277403.1.3400 WP_001277403.1.34015 WP_001277403.1.34041 WP_001277403.1.34074 WP_001277403.1.34083 WP_001277403.1.34085 WP_001277403.1.3409 WP_001277403.1.34120 WP_001277403.1.34127 WP_001277403.1.34176 WP_001277403.1.34212 WP_001277403.1.34272 WP_001277403.1.34297 WP_001277403.1.34327 WP_001277403.1.3437 WP_001277403.1.34378 WP_001277403.1.34449 WP_001277403.1.34474 WP_001277403.1.34506 WP_001277403.1.34519 WP_001277403.1.3458 WP_001277403.1.34586 WP_001277403.1.34598 WP_001277403.1.34601 WP_001277403.1.34603 WP_001277403.1.34616 WP_001277403.1.34644 WP_001277403.1.34662 WP_001277403.1.34674 WP_001277403.1.34713 WP_001277403.1.34739 WP_001277403.1.34742 WP_001277403.1.34754 WP_001277403.1.34776 WP_001277403.1.34792 WP_001277403.1.34796 WP_001277403.1.34809 WP_001277403.1.34839 WP_001277403.1.34848 WP_001277403.1.3486 WP_001277403.1.3487 WP_001277403.1.3488 WP_001277403.1.34886 WP_001277403.1.34899 WP_001277403.1.3494 WP_001277403.1.3496 WP_001277403.1.34995 WP_001277403.1.35020 WP_001277403.1.35027 WP_001277403.1.3505 WP_001277403.1.35098 WP_001277403.1.35133 WP_001277403.1.35151 WP_001277403.1.35152 WP_001277403.1.35167 WP_001277403.1.35217 WP_001277403.1.35218 WP_001277403.1.35247 WP_001277403.1.35251 WP_001277403.1.35254 WP_001277403.1.35290 WP_001277403.1.3530 WP_001277403.1.35305 WP_001277403.1.3532 WP_001277403.1.35411 WP_001277403.1.35501 WP_001277403.1.35523 WP_001277403.1.35541 WP_001277403.1.35597 WP_001277403.1.35614 WP_001277403.1.35616 WP_001277403.1.35625 WP_001277403.1.35708 WP_001277403.1.3571 WP_001277403.1.35721 WP_001277403.1.35743 WP_001277403.1.35773 WP_001277403.1.35798 WP_001277403.1.35827 WP_001277403.1.35834 WP_001277403.1.35836 WP_001277403.1.35875 WP_001277403.1.35919 WP_001277403.1.35920 WP_001277403.1.35924 WP_001277403.1.35932 WP_001277403.1.35943 WP_001277403.1.35957 WP_001277403.1.35967 WP_001277403.1.35972 WP_001277403.1.35974 WP_001277403.1.35981 WP_001277403.1.35986 WP_001277403.1.36 WP_001277403.1.36054 WP_001277403.1.36060 WP_001277403.1.36077 WP_001277403.1.3609 WP_001277403.1.36090 WP_001277403.1.36109 WP_001277403.1.36124 WP_001277403.1.36139 WP_001277403.1.36144 WP_001277403.1.3616 WP_001277403.1.3618 WP_001277403.1.36206 WP_001277403.1.3621 WP_001277403.1.36214 WP_001277403.1.36230 WP_001277403.1.36242 WP_001277403.1.36351 WP_001277403.1.36377 WP_001277403.1.36382 WP_001277403.1.36391 WP_001277403.1.36404 WP_001277403.1.36411 WP_001277403.1.36450 WP_001277403.1.3646 WP_001277403.1.36471 WP_001277403.1.36479 WP_001277403.1.36546 WP_001277403.1.36552 WP_001277403.1.36554 WP_001277403.1.36651 WP_001277403.1.36688 WP_001277403.1.367 WP_001277403.1.36715 WP_001277403.1.36732 WP_001277403.1.36762 WP_001277403.1.36780 WP_001277403.1.36795 WP_001277403.1.36867 WP_001277403.1.36961 WP_001277403.1.36972 WP_001277403.1.36982 WP_001277403.1.36992 WP_001277403.1.36994 WP_001277403.1.37024 WP_001277403.1.37062 WP_001277403.1.37068 WP_001277403.1.37115 WP_001277403.1.37136 WP_001277403.1.37138 WP_001277403.1.37142 WP_001277403.1.37154 WP_001277403.1.37156 WP_001277403.1.37166 WP_001277403.1.37170 WP_001277403.1.37194 WP_001277403.1.37205 WP_001277403.1.37243 WP_001277403.1.37289 WP_001277403.1.37294 WP_001277403.1.37300 WP_001277403.1.37310 WP_001277403.1.37346 WP_001277403.1.37357 WP_001277403.1.37447 WP_001277403.1.37479 WP_001277403.1.37488 WP_001277403.1.37511 WP_001277403.1.37540 WP_001277403.1.3763 WP_001277403.1.37707 WP_001277403.1.37713 WP_001277403.1.37714 WP_001277403.1.37767 WP_001277403.1.37827 WP_001277403.1.37837 WP_001277403.1.37840 WP_001277403.1.37854 WP_001277403.1.37944 WP_001277403.1.37947 WP_001277403.1.38014 WP_001277403.1.38024 WP_001277403.1.38073 WP_001277403.1.38093 WP_001277403.1.38109 WP_001277403.1.38268 WP_001277403.1.38275 WP_001277403.1.38283 WP_001277403.1.3830 WP_001277403.1.38324 WP_001277403.1.38355 WP_001277403.1.38378 WP_001277403.1.38429 WP_001277403.1.3844 WP_001277403.1.38459 WP_001277403.1.38465 WP_001277403.1.38497 WP_001277403.1.38506 WP_001277403.1.38507 WP_001277403.1.38542 WP_001277403.1.38543 WP_001277403.1.38588 WP_001277403.1.38605 WP_001277403.1.38640 WP_001277403.1.38647 WP_001277403.1.38665 WP_001277403.1.38697 WP_001277403.1.387 WP_001277403.1.38712 WP_001277403.1.38718 WP_001277403.1.38723 WP_001277403.1.3876 WP_001277403.1.38796 WP_001277403.1.38805 WP_001277403.1.3885 WP_001277403.1.38860 WP_001277403.1.38887 WP_001277403.1.38918 WP_001277403.1.38930 WP_001277403.1.38934 WP_001277403.1.38955 WP_001277403.1.38957 WP_001277403.1.3897 WP_001277403.1.3899 WP_001277403.1.39006 WP_001277403.1.39051 WP_001277403.1.39071 WP_001277403.1.39074 WP_001277403.1.39076 WP_001277403.1.39079 WP_001277403.1.39083 WP_001277403.1.39133 WP_001277403.1.39139 WP_001277403.1.39151 WP_001277403.1.39192 WP_001277403.1.39227 WP_001277403.1.39270 WP_001277403.1.39292 WP_001277403.1.39318 WP_001277403.1.3932 WP_001277403.1.39320 WP_001277403.1.39322 WP_001277403.1.39336 WP_001277403.1.39339 WP_001277403.1.39357 WP_001277403.1.39394 WP_001277403.1.39412 WP_001277403.1.39431 WP_001277403.1.39453 WP_001277403.1.39454 WP_001277403.1.39479 WP_001277403.1.3948 WP_001277403.1.395 WP_001277403.1.39518 WP_001277403.1.39558 WP_001277403.1.39568 WP_001277403.1.39585 WP_001277403.1.39591 WP_001277403.1.39597 WP_001277403.1.39710 WP_001277403.1.39754 WP_001277403.1.39813 WP_001277403.1.39828 WP_001277403.1.39833 WP_001277403.1.39845 WP_001277403.1.39865 WP_001277403.1.39866 WP_001277403.1.39886 WP_001277403.1.39964 WP_001277403.1.39978 WP_001277403.1.39985 WP_001277403.1.400 WP_001277403.1.40003 WP_001277403.1.40022 WP_001277403.1.40023 WP_001277403.1.40041 WP_001277403.1.4008 WP_001277403.1.40092 WP_001277403.1.40118 WP_001277403.1.40122 WP_001277403.1.40176 WP_001277403.1.40182 WP_001277403.1.40216 WP_001277403.1.40251 WP_001277403.1.40269 WP_001277403.1.40306 WP_001277403.1.40347 WP_001277403.1.40376 WP_001277403.1.4044 WP_001277403.1.40515 WP_001277403.1.40566 WP_001277403.1.40568 WP_001277403.1.40574 WP_001277403.1.40578 WP_001277403.1.40642 WP_001277403.1.40673 WP_001277403.1.40682 WP_001277403.1.40696 WP_001277403.1.40714 WP_001277403.1.4073 WP_001277403.1.40737 WP_001277403.1.40738 WP_001277403.1.40756 WP_001277403.1.40767 WP_001277403.1.40801 WP_001277403.1.40826 WP_001277403.1.4084 WP_001277403.1.40879 WP_001277403.1.40883 WP_001277403.1.40889 WP_001277403.1.40928 WP_001277403.1.40958 WP_001277403.1.40982 WP_001277403.1.41008 WP_001277403.1.41019 WP_001277403.1.41021 WP_001277403.1.41025 WP_001277403.1.41043 WP_001277403.1.41047 WP_001277403.1.41068 WP_001277403.1.41138 WP_001277403.1.41162 WP_001277403.1.4117 WP_001277403.1.41186 WP_001277403.1.41203 WP_001277403.1.41209 WP_001277403.1.41309 WP_001277403.1.41327 WP_001277403.1.4133 WP_001277403.1.41360 WP_001277403.1.41366 WP_001277403.1.41388 WP_001277403.1.4143 WP_001277403.1.4147 WP_001277403.1.41476 WP_001277403.1.415 WP_001277403.1.41523 WP_001277403.1.41594 WP_001277403.1.41673 WP_001277403.1.41684 WP_001277403.1.417 WP_001277403.1.41709 WP_001277403.1.41739 WP_001277403.1.41756 WP_001277403.1.41808 WP_001277403.1.41811 WP_001277403.1.41823 WP_001277403.1.41850 WP_001277403.1.41858 WP_001277403.1.41892 WP_001277403.1.41914 WP_001277403.1.41927 WP_001277403.1.41952 WP_001277403.1.41958 WP_001277403.1.41986 WP_001277403.1.4201 WP_001277403.1.42021 WP_001277403.1.42024 WP_001277403.1.42034 WP_001277403.1.42058 WP_001277403.1.42076 WP_001277403.1.42100 WP_001277403.1.42140 WP_001277403.1.42149 WP_001277403.1.42199 WP_001277403.1.42232 WP_001277403.1.42234 WP_001277403.1.42245 WP_001277403.1.4230 WP_001277403.1.42303 WP_001277403.1.42315 WP_001277403.1.42331 WP_001277403.1.4238 WP_001277403.1.42386 WP_001277403.1.42450 WP_001277403.1.42500 WP_001277403.1.42528 WP_001277403.1.42536 WP_001277403.1.42538 WP_001277403.1.42546 WP_001277403.1.42611 WP_001277403.1.42625 WP_001277403.1.42654 WP_001277403.1.42715 WP_001277403.1.42741 WP_001277403.1.42743 WP_001277403.1.42760 WP_001277403.1.42820 WP_001277403.1.4283 WP_001277403.1.42873 WP_001277403.1.42933 WP_001277403.1.42935 WP_001277403.1.42960 WP_001277403.1.42964 WP_001277403.1.43015 WP_001277403.1.43017 WP_001277403.1.4302 WP_001277403.1.43044 WP_001277403.1.43051 WP_001277403.1.4307 WP_001277403.1.43074 WP_001277403.1.43085 WP_001277403.1.43109 WP_001277403.1.43119 WP_001277403.1.43186 WP_001277403.1.43197 WP_001277403.1.4320 WP_001277403.1.43210 WP_001277403.1.43219 WP_001277403.1.43229 WP_001277403.1.43302 WP_001277403.1.43329 WP_001277403.1.43344 WP_001277403.1.43345 WP_001277403.1.43377 WP_001277403.1.43390 WP_001277403.1.4340 WP_001277403.1.43443 WP_001277403.1.43453 WP_001277403.1.43464 WP_001277403.1.43467 WP_001277403.1.43529 WP_001277403.1.43537 WP_001277403.1.43539 WP_001277403.1.43558 WP_001277403.1.43580 WP_001277403.1.43584 WP_001277403.1.4364 WP_001277403.1.43644 WP_001277403.1.4366 WP_001277403.1.43661 WP_001277403.1.43714 WP_001277403.1.43753 WP_001277403.1.43771 WP_001277403.1.43775 WP_001277403.1.43845 WP_001277403.1.43870 WP_001277403.1.43900 WP_001277403.1.43906 WP_001277403.1.43910 WP_001277403.1.43926 WP_001277403.1.43934 WP_001277403.1.43972 WP_001277403.1.43979 WP_001277403.1.44019 WP_001277403.1.44022 WP_001277403.1.44024 WP_001277403.1.44073 WP_001277403.1.44127 WP_001277403.1.44131 WP_001277403.1.44138 WP_001277403.1.44145 WP_001277403.1.4420 WP_001277403.1.44209 WP_001277403.1.44227 WP_001277403.1.44295 WP_001277403.1.44303 WP_001277403.1.44306 WP_001277403.1.4432 WP_001277403.1.44328 WP_001277403.1.44329 WP_001277403.1.44335 WP_001277403.1.44387 WP_001277403.1.44403 WP_001277403.1.44421 WP_001277403.1.44462 WP_001277403.1.44487 WP_001277403.1.44496 WP_001277403.1.44512 WP_001277403.1.44533 WP_001277403.1.44616 WP_001277403.1.4462 WP_001277403.1.44647 WP_001277403.1.44683 WP_001277403.1.44699 WP_001277403.1.44711 WP_001277403.1.44764 WP_001277403.1.44789 WP_001277403.1.44844 WP_001277403.1.44885 WP_001277403.1.44890 WP_001277403.1.44894 WP_001277403.1.4491 WP_001277403.1.44921 WP_001277403.1.44937 WP_001277403.1.44987 WP_001277403.1.44995 WP_001277403.1.45006 WP_001277403.1.45021 WP_001277403.1.45023 WP_001277403.1.45087 WP_001277403.1.451 WP_001277403.1.45112 WP_001277403.1.4512 WP_001277403.1.45120 WP_001277403.1.45148 WP_001277403.1.45166 WP_001277403.1.45207 WP_001277403.1.45222 WP_001277403.1.4525 WP_001277403.1.45261 WP_001277403.1.45266 WP_001277403.1.45283 WP_001277403.1.45287 WP_001277403.1.45300 WP_001277403.1.45325 WP_001277403.1.45370 WP_001277403.1.45417 WP_001277403.1.4543 WP_001277403.1.45433 WP_001277403.1.45481 WP_001277403.1.45506 WP_001277403.1.45531 WP_001277403.1.4559 WP_001277403.1.45612 WP_001277403.1.45688 WP_001277403.1.45746 WP_001277403.1.45843 WP_001277403.1.45879 WP_001277403.1.45886 WP_001277403.1.45905 WP_001277403.1.45909 WP_001277403.1.45917 WP_001277403.1.45959 WP_001277403.1.45993 WP_001277403.1.45997 WP_001277403.1.46012 WP_001277403.1.46022 WP_001277403.1.46044 WP_001277403.1.46060 WP_001277403.1.46074 WP_001277403.1.46088 WP_001277403.1.46094 WP_001277403.1.46155 WP_001277403.1.46166 WP_001277403.1.46177 WP_001277403.1.46178 WP_001277403.1.46184 WP_001277403.1.46191 WP_001277403.1.4621 WP_001277403.1.46281 WP_001277403.1.4629 WP_001277403.1.46295 WP_001277403.1.46296 WP_001277403.1.46315 WP_001277403.1.46470 WP_001277403.1.46480 WP_001277403.1.46495 WP_001277403.1.46501 WP_001277403.1.46560 WP_001277403.1.46562 WP_001277403.1.46564 WP_001277403.1.46565 WP_001277403.1.4659 WP_001277403.1.46598 WP_001277403.1.46632 WP_001277403.1.46634 WP_001277403.1.46656 WP_001277403.1.46683 WP_001277403.1.46687 WP_001277403.1.46694 WP_001277403.1.46709 WP_001277403.1.46721 WP_001277403.1.46784 WP_001277403.1.46809 WP_001277403.1.46831 WP_001277403.1.46858 WP_001277403.1.46871 WP_001277403.1.46884 WP_001277403.1.469 WP_001277403.1.47017 WP_001277403.1.47043 WP_001277403.1.47056 WP_001277403.1.4707 WP_001277403.1.47091 WP_001277403.1.47133 WP_001277403.1.47168 WP_001277403.1.47183 WP_001277403.1.47213 WP_001277403.1.47327 WP_001277403.1.47365 WP_001277403.1.47394 WP_001277403.1.47395 WP_001277403.1.47409 WP_001277403.1.47415 WP_001277403.1.47513 WP_001277403.1.47596 WP_001277403.1.47620 WP_001277403.1.47633 WP_001277403.1.47657 WP_001277403.1.4768 WP_001277403.1.47699 WP_001277403.1.47766 WP_001277403.1.47771 WP_001277403.1.47785 WP_001277403.1.478 WP_001277403.1.47819 WP_001277403.1.47824 WP_001277403.1.47833 WP_001277403.1.47853 WP_001277403.1.47860 WP_001277403.1.47905 WP_001277403.1.47923 WP_001277403.1.47948 WP_001277403.1.47973 WP_001277403.1.47977 WP_001277403.1.48037 WP_001277403.1.4804 WP_001277403.1.48043 WP_001277403.1.48060 WP_001277403.1.48103 WP_001277403.1.48122 WP_001277403.1.48171 WP_001277403.1.48181 WP_001277403.1.48224 WP_001277403.1.48232 WP_001277403.1.48387 WP_001277403.1.48395 WP_001277403.1.48447 WP_001277403.1.48489 WP_001277403.1.48498 WP_001277403.1.48503 WP_001277403.1.48520 WP_001277403.1.48533 WP_001277403.1.48589 WP_001277403.1.48594 WP_001277403.1.48595 WP_001277403.1.48604 WP_001277403.1.48614 WP_001277403.1.48710 WP_001277403.1.48718 WP_001277403.1.48731 WP_001277403.1.48739 WP_001277403.1.48753 WP_001277403.1.48758 WP_001277403.1.48762 WP_001277403.1.48767 WP_001277403.1.48780 WP_001277403.1.48796 WP_001277403.1.48799 WP_001277403.1.48800 WP_001277403.1.48804 WP_001277403.1.4882 WP_001277403.1.48867 WP_001277403.1.4895 WP_001277403.1.48986 WP_001277403.1.48998 WP_001277403.1.490 WP_001277403.1.49000 WP_001277403.1.49008 WP_001277403.1.49021 WP_001277403.1.49025 WP_001277403.1.49033 WP_001277403.1.49038 WP_001277403.1.49050 WP_001277403.1.49062 WP_001277403.1.49074 WP_001277403.1.49075 WP_001277403.1.49078 WP_001277403.1.49118 WP_001277403.1.49119 WP_001277403.1.49165 WP_001277403.1.49178 WP_001277403.1.49181 WP_001277403.1.49232 WP_001277403.1.49303 WP_001277403.1.49331 WP_001277403.1.49385 WP_001277403.1.49407 WP_001277403.1.49408 WP_001277403.1.49538 WP_001277403.1.49540 WP_001277403.1.49543 WP_001277403.1.4957 WP_001277403.1.49597 WP_001277403.1.49601 WP_001277403.1.49628 WP_001277403.1.49636 WP_001277403.1.49656 WP_001277403.1.49752 WP_001277403.1.49759 WP_001277403.1.49841 WP_001277403.1.49874 WP_001277403.1.49889 WP_001277403.1.49901 WP_001277403.1.49909 WP_001277403.1.49915 WP_001277403.1.49955 WP_001277403.1.4996 WP_001277403.1.49964 WP_001277403.1.49973 WP_001277403.1.49975 WP_001277403.1.5000 WP_001277403.1.50005 WP_001277403.1.50016 WP_001277403.1.50031 WP_001277403.1.50034 WP_001277403.1.50059 WP_001277403.1.50070 WP_001277403.1.50105 WP_001277403.1.50120 WP_001277403.1.50151 WP_001277403.1.502 WP_001277403.1.50209 WP_001277403.1.50234 WP_001277403.1.50246 WP_001277403.1.50263 WP_001277403.1.50281 WP_001277403.1.50296 WP_001277403.1.50305 WP_001277403.1.50311 WP_001277403.1.50315 WP_001277403.1.50318 WP_001277403.1.50327 WP_001277403.1.50383 WP_001277403.1.50454 WP_001277403.1.50501 WP_001277403.1.50532 WP_001277403.1.50560 WP_001277403.1.50572 WP_001277403.1.50580 WP_001277403.1.50582 WP_001277403.1.5060 WP_001277403.1.50603 WP_001277403.1.50613 WP_001277403.1.50615 WP_001277403.1.50621 WP_001277403.1.50628 WP_001277403.1.50637 WP_001277403.1.5065 WP_001277403.1.50657 WP_001277403.1.50685 WP_001277403.1.507 WP_001277403.1.50709 WP_001277403.1.50757 WP_001277403.1.50764 WP_001277403.1.50785 WP_001277403.1.50797 WP_001277403.1.50824 WP_001277403.1.50836 WP_001277403.1.50838 WP_001277403.1.50846 WP_001277403.1.50915 WP_001277403.1.50930 WP_001277403.1.50948 WP_001277403.1.50965 WP_001277403.1.50985 WP_001277403.1.51032 WP_001277403.1.51041 WP_001277403.1.51054 WP_001277403.1.51080 WP_001277403.1.51089 WP_001277403.1.51113 WP_001277403.1.5112 WP_001277403.1.51143 WP_001277403.1.5116 WP_001277403.1.51218 WP_001277403.1.51238 WP_001277403.1.51241 WP_001277403.1.51243 WP_001277403.1.51316 WP_001277403.1.51379 WP_001277403.1.51383 WP_001277403.1.51417 WP_001277403.1.51420 WP_001277403.1.51439 WP_001277403.1.51449 WP_001277403.1.51467 WP_001277403.1.51504 WP_001277403.1.51528 WP_001277403.1.51533 WP_001277403.1.51541 WP_001277403.1.51554 WP_001277403.1.51579 WP_001277403.1.51658 WP_001277403.1.51742 WP_001277403.1.51750 WP_001277403.1.51762 WP_001277403.1.51774 WP_001277403.1.51806 WP_001277403.1.51825 WP_001277403.1.51826 WP_001277403.1.51835 WP_001277403.1.51855 WP_001277403.1.51893 WP_001277403.1.51962 WP_001277403.1.51983 WP_001277403.1.52014 WP_001277403.1.52018 WP_001277403.1.52026 WP_001277403.1.5204 WP_001277403.1.52042 WP_001277403.1.52055 WP_001277403.1.52064 WP_001277403.1.52116 WP_001277403.1.5212 WP_001277403.1.52228 WP_001277403.1.52231 WP_001277403.1.52263 WP_001277403.1.52268 WP_001277403.1.52292 WP_001277403.1.52329 WP_001277403.1.52373 WP_001277403.1.52384 WP_001277403.1.52386 WP_001277403.1.5242 WP_001277403.1.5244 WP_001277403.1.52443 WP_001277403.1.52453 WP_001277403.1.52512 WP_001277403.1.52515 WP_001277403.1.52581 WP_001277403.1.5261 WP_001277403.1.52709 WP_001277403.1.52834 WP_001277403.1.52843 WP_001277403.1.52856 WP_001277403.1.52862 WP_001277403.1.52879 WP_001277403.1.52921 WP_001277403.1.52923 WP_001277403.1.52940 WP_001277403.1.52957 WP_001277403.1.52977 WP_001277403.1.52978 WP_001277403.1.5298 WP_001277403.1.52988 WP_001277403.1.53004 WP_001277403.1.53039 WP_001277403.1.53040 WP_001277403.1.53054 WP_001277403.1.53068 WP_001277403.1.53096 WP_001277403.1.53108 WP_001277403.1.53129 WP_001277403.1.53131 WP_001277403.1.53183 WP_001277403.1.53188 WP_001277403.1.53205 WP_001277403.1.53241 WP_001277403.1.53275 WP_001277403.1.53297 WP_001277403.1.53355 WP_001277403.1.53357 WP_001277403.1.53395 WP_001277403.1.53404 WP_001277403.1.53405 WP_001277403.1.53420 WP_001277403.1.53429 WP_001277403.1.53430 WP_001277403.1.53476 WP_001277403.1.53499 WP_001277403.1.53524 WP_001277403.1.53547 WP_001277403.1.53581 WP_001277403.1.53596 WP_001277403.1.53600 WP_001277403.1.5361 WP_001277403.1.53611 WP_001277403.1.53612 WP_001277403.1.53633 WP_001277403.1.5364 WP_001277403.1.53640 WP_001277403.1.53652 WP_001277403.1.53660 WP_001277403.1.53673 WP_001277403.1.53677 WP_001277403.1.53684 WP_001277403.1.53699 WP_001277403.1.53756 WP_001277403.1.5377 WP_001277403.1.53773 WP_001277403.1.53789 WP_001277403.1.53797 WP_001277403.1.53798 WP_001277403.1.5385 WP_001277403.1.53871 WP_001277403.1.53950 WP_001277403.1.53957 WP_001277403.1.54001 WP_001277403.1.54009 WP_001277403.1.54021 WP_001277403.1.54027 WP_001277403.1.54041 WP_001277403.1.54064 WP_001277403.1.54065 WP_001277403.1.54066 WP_001277403.1.54069 WP_001277403.1.54110 WP_001277403.1.54130 WP_001277403.1.54154 WP_001277403.1.54157 WP_001277403.1.54163 WP_001277403.1.5418 WP_001277403.1.54183 WP_001277403.1.54187 WP_001277403.1.5419 WP_001277403.1.54221 WP_001277403.1.54235 WP_001277403.1.5424 WP_001277403.1.54257 WP_001277403.1.54288 WP_001277403.1.5432 WP_001277403.1.54345 WP_001277403.1.54349 WP_001277403.1.5435 WP_001277403.1.54372 WP_001277403.1.54374 WP_001277403.1.54401 WP_001277403.1.54402 WP_001277403.1.5442 WP_001277403.1.54433 WP_001277403.1.54457 WP_001277403.1.54458 WP_001277403.1.54475 WP_001277403.1.54515 WP_001277403.1.54529 WP_001277403.1.5453 WP_001277403.1.54559 WP_001277403.1.54576 WP_001277403.1.54597 WP_001277403.1.54658 WP_001277403.1.54697 WP_001277403.1.54762 WP_001277403.1.54796 WP_001277403.1.54805 WP_001277403.1.54810 WP_001277403.1.54813 WP_001277403.1.54840 WP_001277403.1.54907 WP_001277403.1.54922 WP_001277403.1.54924 WP_001277403.1.55035 WP_001277403.1.55039 WP_001277403.1.5504 WP_001277403.1.55066 WP_001277403.1.55071 WP_001277403.1.55091 WP_001277403.1.55120 WP_001277403.1.55143 WP_001277403.1.5515 WP_001277403.1.55207 WP_001277403.1.55211 WP_001277403.1.55217 WP_001277403.1.55256 WP_001277403.1.55259 WP_001277403.1.55277 WP_001277403.1.55299 WP_001277403.1.55312 WP_001277403.1.55329 WP_001277403.1.55331 WP_001277403.1.55332 WP_001277403.1.55337 WP_001277403.1.55385 WP_001277403.1.55388 WP_001277403.1.55395 WP_001277403.1.55404 WP_001277403.1.55411 WP_001277403.1.55426 WP_001277403.1.55479 WP_001277403.1.55499 WP_001277403.1.55523 WP_001277403.1.55524 WP_001277403.1.55525 WP_001277403.1.55531 WP_001277403.1.55534 WP_001277403.1.55566 WP_001277403.1.55589 WP_001277403.1.55594 WP_001277403.1.55677 WP_001277403.1.5568 WP_001277403.1.55685 WP_001277403.1.55708 WP_001277403.1.55711 WP_001277403.1.55722 WP_001277403.1.55733 WP_001277403.1.55736 WP_001277403.1.55761 WP_001277403.1.55763 WP_001277403.1.5578 WP_001277403.1.55816 WP_001277403.1.55861 WP_001277403.1.55876 WP_001277403.1.55879 WP_001277403.1.55881 WP_001277403.1.55918 WP_001277403.1.55947 WP_001277403.1.5599 WP_001277403.1.560 WP_001277403.1.56041 WP_001277403.1.56054 WP_001277403.1.56112 WP_001277403.1.56124 WP_001277403.1.56136 WP_001277403.1.5615 WP_001277403.1.56155 WP_001277403.1.56257 WP_001277403.1.56276 WP_001277403.1.56283 WP_001277403.1.56288 WP_001277403.1.56294 WP_001277403.1.56300 WP_001277403.1.56316 WP_001277403.1.56319 WP_001277403.1.56427 WP_001277403.1.56461 WP_001277403.1.56462 WP_001277403.1.56476 WP_001277403.1.56518 WP_001277403.1.56605 WP_001277403.1.56607 WP_001277403.1.56610 WP_001277403.1.56617 WP_001277403.1.56622 WP_001277403.1.56624 WP_001277403.1.5663 WP_001277403.1.56657 WP_001277403.1.56678 WP_001277403.1.56734 WP_001277403.1.56749 WP_001277403.1.56765 WP_001277403.1.56774 WP_001277403.1.56775 WP_001277403.1.56805 WP_001277403.1.56940 WP_001277403.1.56989 WP_001277403.1.56995 WP_001277403.1.57004 WP_001277403.1.57009 WP_001277403.1.57017 WP_001277403.1.57040 WP_001277403.1.5708 WP_001277403.1.5709 WP_001277403.1.57118 WP_001277403.1.57176 WP_001277403.1.57192 WP_001277403.1.57194 WP_001277403.1.57219 WP_001277403.1.57252 WP_001277403.1.57274 WP_001277403.1.57334 WP_001277403.1.57384 WP_001277403.1.57394 WP_001277403.1.57428 WP_001277403.1.57442 WP_001277403.1.57472 WP_001277403.1.57503 WP_001277403.1.57516 WP_001277403.1.57530 WP_001277403.1.5757 WP_001277403.1.57583 WP_001277403.1.57591 WP_001277403.1.57615 WP_001277403.1.57647 WP_001277403.1.57668 WP_001277403.1.57677 WP_001277403.1.57691 WP_001277403.1.57698 WP_001277403.1.57712 WP_001277403.1.57725 WP_001277403.1.57726 WP_001277403.1.57743 WP_001277403.1.57760 WP_001277403.1.57787 WP_001277403.1.57816 WP_001277403.1.57866 WP_001277403.1.57867 WP_001277403.1.57892 WP_001277403.1.57896 WP_001277403.1.57897 WP_001277403.1.57917 WP_001277403.1.5793 WP_001277403.1.57949 WP_001277403.1.57985 WP_001277403.1.5800 WP_001277403.1.58013 WP_001277403.1.58020 WP_001277403.1.58021 WP_001277403.1.5803 WP_001277403.1.58034 WP_001277403.1.58036 WP_001277403.1.58070 WP_001277403.1.581 WP_001277403.1.58124 WP_001277403.1.5813 WP_001277403.1.58135 WP_001277403.1.58171 WP_001277403.1.58211 WP_001277403.1.58217 WP_001277403.1.58225 WP_001277403.1.58243 WP_001277403.1.58264 WP_001277403.1.58341 WP_001277403.1.58344 WP_001277403.1.5835 WP_001277403.1.58378 WP_001277403.1.58402 WP_001277403.1.58434 WP_001277403.1.58437 WP_001277403.1.58452 WP_001277403.1.58474 WP_001277403.1.58480 WP_001277403.1.58522 WP_001277403.1.58553 WP_001277403.1.58554 WP_001277403.1.58563 WP_001277403.1.58574 WP_001277403.1.58595 WP_001277403.1.58613 WP_001277403.1.58615 WP_001277403.1.58642 WP_001277403.1.58645 WP_001277403.1.58653 WP_001277403.1.58684 WP_001277403.1.58717 WP_001277403.1.58738 WP_001277403.1.58761 WP_001277403.1.58841 WP_001277403.1.58854 WP_001277403.1.5887 WP_001277403.1.58905 WP_001277403.1.58959 WP_001277403.1.59007 WP_001277403.1.59028 WP_001277403.1.59033 WP_001277403.1.59065 WP_001277403.1.59066 WP_001277403.1.59109 WP_001277403.1.59137 WP_001277403.1.5916 WP_001277403.1.59160 WP_001277403.1.59198 WP_001277403.1.59208 WP_001277403.1.59215 WP_001277403.1.59235 WP_001277403.1.59257 WP_001277403.1.59289 WP_001277403.1.59356 WP_001277403.1.59361 WP_001277403.1.59365 WP_001277403.1.59367 WP_001277403.1.59370 WP_001277403.1.5939 WP_001277403.1.5941 WP_001277403.1.59424 WP_001277403.1.59468 WP_001277403.1.59497 WP_001277403.1.59532 WP_001277403.1.59534 WP_001277403.1.59552 WP_001277403.1.59558 WP_001277403.1.59607 WP_001277403.1.59608 WP_001277403.1.59637 WP_001277403.1.59666 WP_001277403.1.59670 WP_001277403.1.59678 WP_001277403.1.59700 WP_001277403.1.59718 WP_001277403.1.59721 WP_001277403.1.59740 WP_001277403.1.59785 WP_001277403.1.59859 WP_001277403.1.59883 WP_001277403.1.59884 WP_001277403.1.59895 WP_001277403.1.59913 WP_001277403.1.59918 WP_001277403.1.59935 WP_001277403.1.59951 WP_001277403.1.60026 WP_001277403.1.60064 WP_001277403.1.60210 WP_001277403.1.60242 WP_001277403.1.60248 WP_001277403.1.60256 WP_001277403.1.60281 WP_001277403.1.60298 WP_001277403.1.60303 WP_001277403.1.60309 WP_001277403.1.60385 WP_001277403.1.60388 WP_001277403.1.60391 WP_001277403.1.60420 WP_001277403.1.60438 WP_001277403.1.60485 WP_001277403.1.60521 WP_001277403.1.60529 WP_001277403.1.60615 WP_001277403.1.60645 WP_001277403.1.60646 WP_001277403.1.60693 WP_001277403.1.60714 WP_001277403.1.60723 WP_001277403.1.60731 WP_001277403.1.60749 WP_001277403.1.60756 WP_001277403.1.60815 WP_001277403.1.60886 WP_001277403.1.60911 WP_001277403.1.6092 WP_001277403.1.60924 WP_001277403.1.60961 WP_001277403.1.60977 WP_001277403.1.60993 WP_001277403.1.60996 WP_001277403.1.61007 WP_001277403.1.61021 WP_001277403.1.61028 WP_001277403.1.61043 WP_001277403.1.61050 WP_001277403.1.61088 WP_001277403.1.61151 WP_001277403.1.61159 WP_001277403.1.61160 WP_001277403.1.61164 WP_001277403.1.61182 WP_001277403.1.61217 WP_001277403.1.61220 WP_001277403.1.61236 WP_001277403.1.61250 WP_001277403.1.61302 WP_001277403.1.61307 WP_001277403.1.61348 WP_001277403.1.61365 WP_001277403.1.6137 WP_001277403.1.61372 WP_001277403.1.61378 WP_001277403.1.61386 WP_001277403.1.6140 WP_001277403.1.61404 WP_001277403.1.61423 WP_001277403.1.61444 WP_001277403.1.61451 WP_001277403.1.61471 WP_001277403.1.61489 WP_001277403.1.61499 WP_001277403.1.61506 WP_001277403.1.61513 WP_001277403.1.61514 WP_001277403.1.61531 WP_001277403.1.61541 WP_001277403.1.61560 WP_001277403.1.61568 WP_001277403.1.61605 WP_001277403.1.61606 WP_001277403.1.61627 WP_001277403.1.61632 WP_001277403.1.61686 WP_001277403.1.61733 WP_001277403.1.61735 WP_001277403.1.6174 WP_001277403.1.61751 WP_001277403.1.61801 WP_001277403.1.61807 WP_001277403.1.61837 WP_001277403.1.61845 WP_001277403.1.61848 WP_001277403.1.61882 WP_001277403.1.61896 WP_001277403.1.61912 WP_001277403.1.6192 WP_001277403.1.61934 WP_001277403.1.61959 WP_001277403.1.61964 WP_001277403.1.62000 WP_001277403.1.62001 WP_001277403.1.62006 WP_001277403.1.62022 WP_001277403.1.62062 WP_001277403.1.6207 WP_001277403.1.62118 WP_001277403.1.62137 WP_001277403.1.62145 WP_001277403.1.62161 WP_001277403.1.62167 WP_001277403.1.62174 WP_001277403.1.62178 WP_001277403.1.62190 WP_001277403.1.62197 WP_001277403.1.62220 WP_001277403.1.62235 WP_001277403.1.62283 WP_001277403.1.62287 WP_001277403.1.62315 WP_001277403.1.62366 WP_001277403.1.62390 WP_001277403.1.62394 WP_001277403.1.62397 WP_001277403.1.62417 WP_001277403.1.62421 WP_001277403.1.6244 WP_001277403.1.62465 WP_001277403.1.62518 WP_001277403.1.62524 WP_001277403.1.62532 WP_001277403.1.62540 WP_001277403.1.62546 WP_001277403.1.62581 WP_001277403.1.62600 WP_001277403.1.62613 WP_001277403.1.62615 WP_001277403.1.62638 WP_001277403.1.62670 WP_001277403.1.62775 WP_001277403.1.6279 WP_001277403.1.62793 WP_001277403.1.62803 WP_001277403.1.62821 WP_001277403.1.62836 WP_001277403.1.62862 WP_001277403.1.62994 WP_001277403.1.63033 WP_001277403.1.63034 WP_001277403.1.63055 WP_001277403.1.6306 WP_001277403.1.63075 WP_001277403.1.63077 WP_001277403.1.63128 WP_001277403.1.63149 WP_001277403.1.63156 WP_001277403.1.6316 WP_001277403.1.63230 WP_001277403.1.63235 WP_001277403.1.63238 WP_001277403.1.63329 WP_001277403.1.6341 WP_001277403.1.63425 WP_001277403.1.63430 WP_001277403.1.63468 WP_001277403.1.63473 WP_001277403.1.63503 WP_001277403.1.63543 WP_001277403.1.63587 WP_001277403.1.63621 WP_001277403.1.63675 WP_001277403.1.63691 WP_001277403.1.63753 WP_001277403.1.63756 WP_001277403.1.63787 WP_001277403.1.63792 WP_001277403.1.6382 WP_001277403.1.63846 WP_001277403.1.63859 WP_001277403.1.63882 WP_001277403.1.63908 WP_001277403.1.63920 WP_001277403.1.6393 WP_001277403.1.63931 WP_001277403.1.63935 WP_001277403.1.63943 WP_001277403.1.63971 WP_001277403.1.63988 WP_001277403.1.64002 WP_001277403.1.64006 WP_001277403.1.64042 WP_001277403.1.64055 WP_001277403.1.64067 WP_001277403.1.64090 WP_001277403.1.6410 WP_001277403.1.64113 WP_001277403.1.6414 WP_001277403.1.64172 WP_001277403.1.64184 WP_001277403.1.64225 WP_001277403.1.64267 WP_001277403.1.64316 WP_001277403.1.64320 WP_001277403.1.64338 WP_001277403.1.64359 WP_001277403.1.64373 WP_001277403.1.64416 WP_001277403.1.64449 WP_001277403.1.64490 WP_001277403.1.64518 WP_001277403.1.6467 WP_001277403.1.64679 WP_001277403.1.64696 WP_001277403.1.64698 WP_001277403.1.64719 WP_001277403.1.64725 WP_001277403.1.64728 WP_001277403.1.64733 WP_001277403.1.64739 WP_001277403.1.6474 WP_001277403.1.64750 WP_001277403.1.64816 WP_001277403.1.64837 WP_001277403.1.64839 WP_001277403.1.6485 WP_001277403.1.64855 WP_001277403.1.64857 WP_001277403.1.64871 WP_001277403.1.64876 WP_001277403.1.64882 WP_001277403.1.64890 WP_001277403.1.649 WP_001277403.1.64906 WP_001277403.1.6491 WP_001277403.1.64917 WP_001277403.1.64925 WP_001277403.1.64931 WP_001277403.1.64960 WP_001277403.1.6498 WP_001277403.1.64993 WP_001277403.1.6504 WP_001277403.1.6505 WP_001277403.1.65062 WP_001277403.1.65091 WP_001277403.1.65126 WP_001277403.1.65159 WP_001277403.1.65232 WP_001277403.1.65268 WP_001277403.1.6529 WP_001277403.1.65331 WP_001277403.1.65336 WP_001277403.1.65339 WP_001277403.1.65344 WP_001277403.1.65352 WP_001277403.1.65362 WP_001277403.1.65371 WP_001277403.1.6538 WP_001277403.1.65396 WP_001277403.1.65418 WP_001277403.1.65452 WP_001277403.1.65476 WP_001277403.1.65485 WP_001277403.1.65489 WP_001277403.1.65492 WP_001277403.1.65523 WP_001277403.1.65568 WP_001277403.1.65574 WP_001277403.1.65587 WP_001277403.1.65607 WP_001277403.1.65641 WP_001277403.1.65657 WP_001277403.1.65722 WP_001277403.1.65748 WP_001277403.1.6577 WP_001277403.1.65789 WP_001277403.1.6580 WP_001277403.1.65814 WP_001277403.1.65837 WP_001277403.1.65853 WP_001277403.1.65897 WP_001277403.1.65916 WP_001277403.1.65936 WP_001277403.1.65941 WP_001277403.1.6598 WP_001277403.1.66003 WP_001277403.1.66006 WP_001277403.1.66024 WP_001277403.1.66045 WP_001277403.1.66046 WP_001277403.1.66053 WP_001277403.1.66087 WP_001277403.1.66115 WP_001277403.1.66146 WP_001277403.1.66166 WP_001277403.1.66170 WP_001277403.1.66207 WP_001277403.1.6621 WP_001277403.1.66230 WP_001277403.1.66274 WP_001277403.1.66278 WP_001277403.1.663 WP_001277403.1.66333 WP_001277403.1.66356 WP_001277403.1.66381 WP_001277403.1.66399 WP_001277403.1.66411 WP_001277403.1.66468 WP_001277403.1.66470 WP_001277403.1.66477 WP_001277403.1.66490 WP_001277403.1.66497 WP_001277403.1.66536 WP_001277403.1.66569 WP_001277403.1.66595 WP_001277403.1.66637 WP_001277403.1.66653 WP_001277403.1.66654 WP_001277403.1.66674 WP_001277403.1.66687 WP_001277403.1.66734 WP_001277403.1.66745 WP_001277403.1.66781 WP_001277403.1.66797 WP_001277403.1.66813 WP_001277403.1.66829 WP_001277403.1.66861 WP_001277403.1.66894 WP_001277403.1.669 WP_001277403.1.66917 WP_001277403.1.6694 WP_001277403.1.6695 WP_001277403.1.66964 WP_001277403.1.66983 WP_001277403.1.67039 WP_001277403.1.67056 WP_001277403.1.67096 WP_001277403.1.67148 WP_001277403.1.67151 WP_001277403.1.67169 WP_001277403.1.67196 WP_001277403.1.67206 WP_001277403.1.67215 WP_001277403.1.67222 WP_001277403.1.67274 WP_001277403.1.673 WP_001277403.1.67304 WP_001277403.1.67349 WP_001277403.1.67398 WP_001277403.1.67401 WP_001277403.1.67432 WP_001277403.1.67443 WP_001277403.1.67508 WP_001277403.1.67515 WP_001277403.1.67557 WP_001277403.1.6759 WP_001277403.1.67594 WP_001277403.1.67613 WP_001277403.1.67648 WP_001277403.1.67655 WP_001277403.1.67684 WP_001277403.1.67739 WP_001277403.1.67741 WP_001277403.1.67804 WP_001277403.1.67921 WP_001277403.1.67930 WP_001277403.1.6795 WP_001277403.1.67950 WP_001277403.1.67965 WP_001277403.1.67967 WP_001277403.1.68002 WP_001277403.1.68017 WP_001277403.1.68048 WP_001277403.1.68061 WP_001277403.1.68077 WP_001277403.1.681 WP_001277403.1.6812 WP_001277403.1.68181 WP_001277403.1.68220 WP_001277403.1.68238 WP_001277403.1.6826 WP_001277403.1.68306 WP_001277403.1.68323 WP_001277403.1.68393 WP_001277403.1.68406 WP_001277403.1.68427 WP_001277403.1.68430 WP_001277403.1.68453 WP_001277403.1.68458 WP_001277403.1.68494 WP_001277403.1.68508 WP_001277403.1.68531 WP_001277403.1.68535 WP_001277403.1.68544 WP_001277403.1.68557 WP_001277403.1.68567 WP_001277403.1.68578 WP_001277403.1.68595 WP_001277403.1.68597 WP_001277403.1.68653 WP_001277403.1.68660 WP_001277403.1.68661 WP_001277403.1.68671 WP_001277403.1.68682 WP_001277403.1.68712 WP_001277403.1.68729 WP_001277403.1.68777 WP_001277403.1.68784 WP_001277403.1.68814 WP_001277403.1.68820 WP_001277403.1.68825 WP_001277403.1.68835 WP_001277403.1.6890 WP_001277403.1.68939 WP_001277403.1.6894 WP_001277403.1.68960 WP_001277403.1.68992 WP_001277403.1.690 WP_001277403.1.69000 WP_001277403.1.69005 WP_001277403.1.69017 WP_001277403.1.69052 WP_001277403.1.69065 WP_001277403.1.69073 WP_001277403.1.69097 WP_001277403.1.69116 WP_001277403.1.69137 WP_001277403.1.69148 WP_001277403.1.69211 WP_001277403.1.69215 WP_001277403.1.69246 WP_001277403.1.69285 WP_001277403.1.69292 WP_001277403.1.69313 WP_001277403.1.69321 WP_001277403.1.69326 WP_001277403.1.69407 WP_001277403.1.69428 WP_001277403.1.69431 WP_001277403.1.69493 WP_001277403.1.69531 WP_001277403.1.69541 WP_001277403.1.69543 WP_001277403.1.69549 WP_001277403.1.69557 WP_001277403.1.69560 WP_001277403.1.69591 WP_001277403.1.69626 WP_001277403.1.69653 WP_001277403.1.69670 WP_001277403.1.69671 WP_001277403.1.69731 WP_001277403.1.69739 WP_001277403.1.69752 WP_001277403.1.69757 WP_001277403.1.69797 WP_001277403.1.69825 WP_001277403.1.69850 WP_001277403.1.69869 WP_001277403.1.6988 WP_001277403.1.69905 WP_001277403.1.69917 WP_001277403.1.69940 WP_001277403.1.69946 WP_001277403.1.69962 WP_001277403.1.7 WP_001277403.1.70011 WP_001277403.1.70046 WP_001277403.1.70056 WP_001277403.1.70073 WP_001277403.1.7008 WP_001277403.1.70119 WP_001277403.1.70150 WP_001277403.1.70156 WP_001277403.1.70159 WP_001277403.1.70166 WP_001277403.1.7018 WP_001277403.1.70192 WP_001277403.1.70199 WP_001277403.1.70221 WP_001277403.1.70223 WP_001277403.1.70224 WP_001277403.1.70279 WP_001277403.1.70302 WP_001277403.1.70308 WP_001277403.1.70315 WP_001277403.1.70400 WP_001277403.1.70409 WP_001277403.1.70421 WP_001277403.1.70430 WP_001277403.1.70453 WP_001277403.1.70513 WP_001277403.1.70520 WP_001277403.1.70524 WP_001277403.1.70528 WP_001277403.1.70532 WP_001277403.1.70535 WP_001277403.1.70536 WP_001277403.1.70538 WP_001277403.1.70567 WP_001277403.1.7057 WP_001277403.1.7059 WP_001277403.1.70617 WP_001277403.1.70629 WP_001277403.1.70630 WP_001277403.1.70674 WP_001277403.1.70707 WP_001277403.1.7075 WP_001277403.1.70828 WP_001277403.1.70838 WP_001277403.1.70867 WP_001277403.1.70876 WP_001277403.1.70916 WP_001277403.1.70931 WP_001277403.1.70949 WP_001277403.1.70951 WP_001277403.1.70961 WP_001277403.1.70987 WP_001277403.1.70988 WP_001277403.1.71020 WP_001277403.1.71030 WP_001277403.1.71051 WP_001277403.1.71078 WP_001277403.1.71082 WP_001277403.1.7112 WP_001277403.1.71121 WP_001277403.1.7126 WP_001277403.1.71277 WP_001277403.1.71283 WP_001277403.1.71360 WP_001277403.1.71369 WP_001277403.1.71415 WP_001277403.1.71460 WP_001277403.1.71551 WP_001277403.1.71565 WP_001277403.1.71599 WP_001277403.1.71622 WP_001277403.1.7167 WP_001277403.1.71675 WP_001277403.1.7173 WP_001277403.1.71742 WP_001277403.1.71758 WP_001277403.1.71773 WP_001277403.1.71782 WP_001277403.1.71787 WP_001277403.1.71824 WP_001277403.1.71849 WP_001277403.1.71880 WP_001277403.1.71905 WP_001277403.1.71926 WP_001277403.1.71955 WP_001277403.1.71959 WP_001277403.1.72071 WP_001277403.1.72082 WP_001277403.1.72088 WP_001277403.1.72095 WP_001277403.1.721 WP_001277403.1.72135 WP_001277403.1.7214 WP_001277403.1.72147 WP_001277403.1.72163 WP_001277403.1.72192 WP_001277403.1.72233 WP_001277403.1.72242 WP_001277403.1.72251 WP_001277403.1.72321 WP_001277403.1.72368 WP_001277403.1.72390 WP_001277403.1.72407 WP_001277403.1.72416 WP_001277403.1.72426 WP_001277403.1.72454 WP_001277403.1.72472 WP_001277403.1.72474 WP_001277403.1.72502 WP_001277403.1.72534 WP_001277403.1.72542 WP_001277403.1.72565 WP_001277403.1.72595 WP_001277403.1.72610 WP_001277403.1.72628 WP_001277403.1.72630 WP_001277403.1.72646 WP_001277403.1.7268 WP_001277403.1.72705 WP_001277403.1.7271 WP_001277403.1.72854 WP_001277403.1.72932 WP_001277403.1.72934 WP_001277403.1.72940 WP_001277403.1.72942 WP_001277403.1.73008 WP_001277403.1.73043 WP_001277403.1.73051 WP_001277403.1.73058 WP_001277403.1.73064 WP_001277403.1.73065 WP_001277403.1.73071 WP_001277403.1.73089 WP_001277403.1.73099 WP_001277403.1.73100 WP_001277403.1.73106 WP_001277403.1.73133 WP_001277403.1.73178 WP_001277403.1.73185 WP_001277403.1.73214 WP_001277403.1.73288 WP_001277403.1.73320 WP_001277403.1.73324 WP_001277403.1.73336 WP_001277403.1.73356 WP_001277403.1.73357 WP_001277403.1.73359 WP_001277403.1.73369 WP_001277403.1.73438 WP_001277403.1.73462 WP_001277403.1.7347 WP_001277403.1.73500 WP_001277403.1.7352 WP_001277403.1.73520 WP_001277403.1.73522 WP_001277403.1.73525 WP_001277403.1.73548 WP_001277403.1.73568 WP_001277403.1.73588 WP_001277403.1.7359 WP_001277403.1.73593 WP_001277403.1.73622 WP_001277403.1.73665 WP_001277403.1.73666 WP_001277403.1.73675 WP_001277403.1.73710 WP_001277403.1.73725 WP_001277403.1.73726 WP_001277403.1.73747 WP_001277403.1.73771 WP_001277403.1.73812 WP_001277403.1.73851 WP_001277403.1.73890 WP_001277403.1.73907 WP_001277403.1.73939 WP_001277403.1.7397 WP_001277403.1.73979 WP_001277403.1.74011 WP_001277403.1.74015 WP_001277403.1.74033 WP_001277403.1.74075 WP_001277403.1.7409 WP_001277403.1.74139 WP_001277403.1.74231 WP_001277403.1.74233 WP_001277403.1.74239 WP_001277403.1.74250 WP_001277403.1.74260 WP_001277403.1.74293 WP_001277403.1.74308 WP_001277403.1.7431 WP_001277403.1.74314 WP_001277403.1.74330 WP_001277403.1.74331 WP_001277403.1.74341 WP_001277403.1.74364 WP_001277403.1.74385 WP_001277403.1.74387 WP_001277403.1.74396 WP_001277403.1.74516 WP_001277403.1.74537 WP_001277403.1.74548 WP_001277403.1.74550 WP_001277403.1.74582 WP_001277403.1.74618 WP_001277403.1.7466 WP_001277403.1.7468 WP_001277403.1.74762 WP_001277403.1.74822 WP_001277403.1.74848 WP_001277403.1.7485 WP_001277403.1.74877 WP_001277403.1.7488 WP_001277403.1.74940 WP_001277403.1.74974 WP_001277403.1.7505 WP_001277403.1.75062 WP_001277403.1.75074 WP_001277403.1.75154 WP_001277403.1.75156 WP_001277403.1.7517 WP_001277403.1.75191 WP_001277403.1.75259 WP_001277403.1.75260 WP_001277403.1.7527 WP_001277403.1.75284 WP_001277403.1.75312 WP_001277403.1.75317 WP_001277403.1.75335 WP_001277403.1.75370 WP_001277403.1.75384 WP_001277403.1.75406 WP_001277403.1.75455 WP_001277403.1.75464 WP_001277403.1.75469 WP_001277403.1.75490 WP_001277403.1.75511 WP_001277403.1.75534 WP_001277403.1.7554 WP_001277403.1.75546 WP_001277403.1.75582 WP_001277403.1.75586 WP_001277403.1.75648 WP_001277403.1.75654 WP_001277403.1.75675 WP_001277403.1.75701 WP_001277403.1.75709 WP_001277403.1.75729 WP_001277403.1.75752 WP_001277403.1.75817 WP_001277403.1.75834 WP_001277403.1.75845 WP_001277403.1.75876 WP_001277403.1.75987 WP_001277403.1.75996 WP_001277403.1.76018 WP_001277403.1.76056 WP_001277403.1.76080 WP_001277403.1.76093 WP_001277403.1.76161 WP_001277403.1.76195 WP_001277403.1.76220 WP_001277403.1.76263 WP_001277403.1.76264 WP_001277403.1.76285 WP_001277403.1.76293 WP_001277403.1.76303 WP_001277403.1.76439 WP_001277403.1.76458 WP_001277403.1.76492 WP_001277403.1.76517 WP_001277403.1.76530 WP_001277403.1.76564 WP_001277403.1.76567 WP_001277403.1.76570 WP_001277403.1.76594 WP_001277403.1.76650 WP_001277403.1.76667 WP_001277403.1.76675 WP_001277403.1.76692 WP_001277403.1.76722 WP_001277403.1.7673 WP_001277403.1.76761 WP_001277403.1.76764 WP_001277403.1.76826 WP_001277403.1.76830 WP_001277403.1.76837 WP_001277403.1.76850 WP_001277403.1.76862 WP_001277403.1.76868 WP_001277403.1.76874 WP_001277403.1.76892 WP_001277403.1.76927 WP_001277403.1.76942 WP_001277403.1.76972 WP_001277403.1.77 WP_001277403.1.77037 WP_001277403.1.7706 WP_001277403.1.77094 WP_001277403.1.77123 WP_001277403.1.7713 WP_001277403.1.77130 WP_001277403.1.7714 WP_001277403.1.77167 WP_001277403.1.77223 WP_001277403.1.77310 WP_001277403.1.7735 WP_001277403.1.77379 WP_001277403.1.77410 WP_001277403.1.77434 WP_001277403.1.77468 WP_001277403.1.77480 WP_001277403.1.77483 WP_001277403.1.77505 WP_001277403.1.77534 WP_001277403.1.77535 WP_001277403.1.77552 WP_001277403.1.77568 WP_001277403.1.77582 WP_001277403.1.7761 WP_001277403.1.77610 WP_001277403.1.77701 WP_001277403.1.77731 WP_001277403.1.77747 WP_001277403.1.77755 WP_001277403.1.77765 WP_001277403.1.77770 WP_001277403.1.77779 WP_001277403.1.77780 WP_001277403.1.77808 WP_001277403.1.77839 WP_001277403.1.77877 WP_001277403.1.77906 WP_001277403.1.77912 WP_001277403.1.77944 WP_001277403.1.77976 WP_001277403.1.78003 WP_001277403.1.78025 WP_001277403.1.78030 WP_001277403.1.78068 WP_001277403.1.78108 WP_001277403.1.7813 WP_001277403.1.78139 WP_001277403.1.78211 WP_001277403.1.7822 WP_001277403.1.78253 WP_001277403.1.78270 WP_001277403.1.78298 WP_001277403.1.78318 WP_001277403.1.78343 WP_001277403.1.78349 WP_001277403.1.78379 WP_001277403.1.78395 WP_001277403.1.78397 WP_001277403.1.78422 WP_001277403.1.78454 WP_001277403.1.78455 WP_001277403.1.78457 WP_001277403.1.78465 WP_001277403.1.78467 WP_001277403.1.78475 WP_001277403.1.78535 WP_001277403.1.78541 WP_001277403.1.78546 WP_001277403.1.78588 WP_001277403.1.78609 WP_001277403.1.78656 WP_001277403.1.78710 WP_001277403.1.78724 WP_001277403.1.78733 WP_001277403.1.78755 WP_001277403.1.7876 WP_001277403.1.78794 WP_001277403.1.78796 WP_001277403.1.78828 WP_001277403.1.78832 WP_001277403.1.78865 WP_001277403.1.78866 WP_001277403.1.78870 WP_001277403.1.78876 WP_001277403.1.78890 WP_001277403.1.78915 WP_001277403.1.78965 WP_001277403.1.78979 WP_001277403.1.79008 WP_001277403.1.79040 WP_001277403.1.79073 WP_001277403.1.79079 WP_001277403.1.79096 WP_001277403.1.7910 WP_001277403.1.79104 WP_001277403.1.79124 WP_001277403.1.79134 WP_001277403.1.79157 WP_001277403.1.79173 WP_001277403.1.79187 WP_001277403.1.7919 WP_001277403.1.79202 WP_001277403.1.79228 WP_001277403.1.7924 WP_001277403.1.79245 WP_001277403.1.79316 WP_001277403.1.79329 WP_001277403.1.79349 WP_001277403.1.79410 WP_001277403.1.79418 WP_001277403.1.79469 WP_001277403.1.7950 WP_001277403.1.79527 WP_001277403.1.79612 WP_001277403.1.79669 WP_001277403.1.79675 WP_001277403.1.7968 WP_001277403.1.79688 WP_001277403.1.79693 WP_001277403.1.79705 WP_001277403.1.79746 WP_001277403.1.79841 WP_001277403.1.79849 WP_001277403.1.79899 WP_001277403.1.79927 WP_001277403.1.79940 WP_001277403.1.7998 WP_001277403.1.80005 WP_001277403.1.80019 WP_001277403.1.8003 WP_001277403.1.80049 WP_001277403.1.80070 WP_001277403.1.80074 WP_001277403.1.80093 WP_001277403.1.80148 WP_001277403.1.80196 WP_001277403.1.80200 WP_001277403.1.80207 WP_001277403.1.80228 WP_001277403.1.80231 WP_001277403.1.80248 WP_001277403.1.80251 WP_001277403.1.80268 WP_001277403.1.80279 WP_001277403.1.80294 WP_001277403.1.80314 WP_001277403.1.80349 WP_001277403.1.80357 WP_001277403.1.80367 WP_001277403.1.80373 WP_001277403.1.8041 WP_001277403.1.80457 WP_001277403.1.80467 WP_001277403.1.80475 WP_001277403.1.8048 WP_001277403.1.80539 WP_001277403.1.80550 WP_001277403.1.80557 WP_001277403.1.80596 WP_001277403.1.80597 WP_001277403.1.80689 WP_001277403.1.80691 WP_001277403.1.80700 WP_001277403.1.80758 WP_001277403.1.80765 WP_001277403.1.80775 WP_001277403.1.80856 WP_001277403.1.80875 WP_001277403.1.80885 WP_001277403.1.80914 WP_001277403.1.80951 WP_001277403.1.80990 WP_001277403.1.81012 WP_001277403.1.81117 WP_001277403.1.81134 WP_001277403.1.81201 WP_001277403.1.81241 WP_001277403.1.81256 WP_001277403.1.81296 WP_001277403.1.81311 WP_001277403.1.81360 WP_001277403.1.81375 WP_001277403.1.81381 WP_001277403.1.81390 WP_001277403.1.81395 WP_001277403.1.81398 WP_001277403.1.81408 WP_001277403.1.81473 WP_001277403.1.81492 WP_001277403.1.81498 WP_001277403.1.815 WP_001277403.1.81500 WP_001277403.1.81530 WP_001277403.1.81534 WP_001277403.1.8154 WP_001277403.1.81586 WP_001277403.1.81616 WP_001277403.1.81677 WP_001277403.1.81703 WP_001277403.1.81707 WP_001277403.1.81716 WP_001277403.1.81729 WP_001277403.1.81857 WP_001277403.1.81890 WP_001277403.1.81894 WP_001277403.1.81959 WP_001277403.1.81984 WP_001277403.1.82005 WP_001277403.1.82020 WP_001277403.1.82033 WP_001277403.1.82042 WP_001277403.1.82051 WP_001277403.1.82052 WP_001277403.1.82094 WP_001277403.1.82159 WP_001277403.1.82181 WP_001277403.1.82191 WP_001277403.1.82213 WP_001277403.1.82252 WP_001277403.1.82284 WP_001277403.1.82297 WP_001277403.1.82298 WP_001277403.1.82306 WP_001277403.1.82342 WP_001277403.1.82353 WP_001277403.1.82386 WP_001277403.1.82407 WP_001277403.1.82422 WP_001277403.1.82425 WP_001277403.1.82459 WP_001277403.1.8248 WP_001277403.1.82481 WP_001277403.1.82528 WP_001277403.1.82537 WP_001277403.1.82552 WP_001277403.1.8257 WP_001277403.1.82600 WP_001277403.1.82603 WP_001277403.1.82666 WP_001277403.1.82699 WP_001277403.1.82733 WP_001277403.1.82736 WP_001277403.1.8275 WP_001277403.1.82750 WP_001277403.1.82758 WP_001277403.1.82827 WP_001277403.1.8283 WP_001277403.1.82840 WP_001277403.1.82847 WP_001277403.1.82869 WP_001277403.1.82885 WP_001277403.1.82900 WP_001277403.1.82918 WP_001277403.1.8293 WP_001277403.1.82958 WP_001277403.1.82969 WP_001277403.1.82985 WP_001277403.1.83055 WP_001277403.1.83064 WP_001277403.1.83067 WP_001277403.1.83094 WP_001277403.1.83107 WP_001277403.1.83136 WP_001277403.1.8315 WP_001277403.1.83174 WP_001277403.1.83183 WP_001277403.1.83199 WP_001277403.1.83219 WP_001277403.1.83231 WP_001277403.1.83239 WP_001277403.1.83241 WP_001277403.1.83278 WP_001277403.1.83281 WP_001277403.1.83306 WP_001277403.1.8331 WP_001277403.1.83311 WP_001277403.1.83319 WP_001277403.1.83414 WP_001277403.1.83439 WP_001277403.1.83443 WP_001277403.1.83456 WP_001277403.1.83471 WP_001277403.1.83485 WP_001277403.1.83527 WP_001277403.1.83565 WP_001277403.1.83574 WP_001277403.1.83578 WP_001277403.1.83587 WP_001277403.1.8360 WP_001277403.1.83606 WP_001277403.1.83613 WP_001277403.1.83635 WP_001277403.1.83702 WP_001277403.1.83713 WP_001277403.1.83726 WP_001277403.1.83731 WP_001277403.1.83732 WP_001277403.1.83752 WP_001277403.1.83789 WP_001277403.1.83790 WP_001277403.1.83796 WP_001277403.1.83840 WP_001277403.1.83843 WP_001277403.1.83846 WP_001277403.1.83916 WP_001277403.1.8392 WP_001277403.1.83934 WP_001277403.1.83956 WP_001277403.1.83961 WP_001277403.1.83962 WP_001277403.1.83963 WP_001277403.1.83974 WP_001277403.1.83978 WP_001277403.1.8398 WP_001277403.1.84013 WP_001277403.1.84038 WP_001277403.1.84052 WP_001277403.1.84065 WP_001277403.1.84092 WP_001277403.1.84095 WP_001277403.1.84113 WP_001277403.1.84147 WP_001277403.1.84211 WP_001277403.1.84213 WP_001277403.1.84225 WP_001277403.1.84258 WP_001277403.1.84263 WP_001277403.1.84292 WP_001277403.1.84304 WP_001277403.1.84305 WP_001277403.1.84321 WP_001277403.1.8438 WP_001277403.1.84444 WP_001277403.1.84505 WP_001277403.1.84513 WP_001277403.1.84530 WP_001277403.1.84552 WP_001277403.1.84576 WP_001277403.1.84613 WP_001277403.1.84636 WP_001277403.1.84640 WP_001277403.1.84658 WP_001277403.1.84669 WP_001277403.1.84672 WP_001277403.1.84724 WP_001277403.1.84746 WP_001277403.1.84747 WP_001277403.1.84785 WP_001277403.1.8481 WP_001277403.1.84821 WP_001277403.1.84827 WP_001277403.1.8483 WP_001277403.1.84858 WP_001277403.1.8486 WP_001277403.1.84897 WP_001277403.1.84931 WP_001277403.1.84979 WP_001277403.1.84991 WP_001277403.1.84998 WP_001277403.1.8500 WP_001277403.1.8506 WP_001277403.1.85061 WP_001277403.1.85062 WP_001277403.1.8507 WP_001277403.1.85095 WP_001277403.1.8510 WP_001277403.1.85103 WP_001277403.1.85123 WP_001277403.1.85195 WP_001277403.1.85212 WP_001277403.1.85215 WP_001277403.1.85221 WP_001277403.1.85232 WP_001277403.1.85373 WP_001277403.1.85400 WP_001277403.1.85418 WP_001277403.1.85427 WP_001277403.1.8547 WP_001277403.1.85470 WP_001277403.1.85522 WP_001277403.1.85526 WP_001277403.1.85548 WP_001277403.1.85581 WP_001277403.1.85609 WP_001277403.1.85612 WP_001277403.1.85624 WP_001277403.1.85652 WP_001277403.1.85718 WP_001277403.1.8574 WP_001277403.1.85861 WP_001277403.1.85869 WP_001277403.1.85882 WP_001277403.1.85907 WP_001277403.1.85921 WP_001277403.1.85942 WP_001277403.1.85973 WP_001277403.1.86013 WP_001277403.1.86061 WP_001277403.1.86112 WP_001277403.1.86118 WP_001277403.1.8612 WP_001277403.1.8618 WP_001277403.1.86211 WP_001277403.1.86238 WP_001277403.1.86296 WP_001277403.1.86300 WP_001277403.1.86312 WP_001277403.1.86313 WP_001277403.1.86320 WP_001277403.1.86330 WP_001277403.1.86346 WP_001277403.1.86403 WP_001277403.1.86445 WP_001277403.1.86507 WP_001277403.1.86546 WP_001277403.1.8655 WP_001277403.1.86558 WP_001277403.1.86559 WP_001277403.1.86612 WP_001277403.1.86631 WP_001277403.1.86632 WP_001277403.1.86685 WP_001277403.1.86689 WP_001277403.1.86702 WP_001277403.1.86722 WP_001277403.1.86742 WP_001277403.1.86747 WP_001277403.1.86751 WP_001277403.1.86812 WP_001277403.1.86841 WP_001277403.1.86866 WP_001277403.1.86918 WP_001277403.1.86939 WP_001277403.1.86996 WP_001277403.1.87065 WP_001277403.1.87077 WP_001277403.1.8708 WP_001277403.1.87084 WP_001277403.1.87094 WP_001277403.1.87135 WP_001277403.1.87138 WP_001277403.1.87174 WP_001277403.1.87186 WP_001277403.1.87200 WP_001277403.1.87289 WP_001277403.1.87297 WP_001277403.1.87336 WP_001277403.1.8734 WP_001277403.1.87548 WP_001277403.1.87550 WP_001277403.1.87575 WP_001277403.1.87604 WP_001277403.1.87681 WP_001277403.1.87771 WP_001277403.1.87775 WP_001277403.1.87799 WP_001277403.1.87815 WP_001277403.1.87824 WP_001277403.1.87829 WP_001277403.1.87833 WP_001277403.1.87868 WP_001277403.1.87872 WP_001277403.1.87904 WP_001277403.1.87909 WP_001277403.1.87969 WP_001277403.1.87993 WP_001277403.1.88054 WP_001277403.1.88113 WP_001277403.1.88129 WP_001277403.1.88196 WP_001277403.1.88232 WP_001277403.1.88280 WP_001277403.1.883 WP_001277403.1.88343 WP_001277403.1.88433 WP_001277403.1.88488 WP_001277403.1.88509 WP_001277403.1.88523 WP_001277403.1.8858 WP_001277403.1.88602 WP_001277403.1.88662 WP_001277403.1.88699 WP_001277403.1.88700 WP_001277403.1.88716 WP_001277403.1.88719 WP_001277403.1.88722 WP_001277403.1.88811 WP_001277403.1.88840 WP_001277403.1.88869 WP_001277403.1.88932 WP_001277403.1.88939 WP_001277403.1.88940 WP_001277403.1.88955 WP_001277403.1.89029 WP_001277403.1.89034 WP_001277403.1.89094 WP_001277403.1.89123 WP_001277403.1.89134 WP_001277403.1.89161 WP_001277403.1.89208 WP_001277403.1.89210 WP_001277403.1.89254 WP_001277403.1.89282 WP_001277403.1.8930 WP_001277403.1.89310 WP_001277403.1.89346 WP_001277403.1.89442 WP_001277403.1.89446 WP_001277403.1.89498 WP_001277403.1.89504 WP_001277403.1.89532 WP_001277403.1.89585 WP_001277403.1.89620 WP_001277403.1.89624 WP_001277403.1.89645 WP_001277403.1.89652 WP_001277403.1.89654 WP_001277403.1.89658 WP_001277403.1.89681 WP_001277403.1.89684 WP_001277403.1.89702 WP_001277403.1.8973 WP_001277403.1.8975 WP_001277403.1.89757 WP_001277403.1.89763 WP_001277403.1.89806 WP_001277403.1.89828 WP_001277403.1.89843 WP_001277403.1.89858 WP_001277403.1.89864 WP_001277403.1.89881 WP_001277403.1.89887 WP_001277403.1.89891 WP_001277403.1.89907 WP_001277403.1.89942 WP_001277403.1.89967 WP_001277403.1.90001 WP_001277403.1.90010 WP_001277403.1.90028 WP_001277403.1.90035 WP_001277403.1.90059 WP_001277403.1.90071 WP_001277403.1.90113 WP_001277403.1.90119 WP_001277403.1.90124 WP_001277403.1.90158 WP_001277403.1.90186 WP_001277403.1.90213 WP_001277403.1.90281 WP_001277403.1.90312 WP_001277403.1.90313 WP_001277403.1.90319 WP_001277403.1.90361 WP_001277403.1.90397 WP_001277403.1.90425 WP_001277403.1.90443 WP_001277403.1.90482 WP_001277403.1.90502 WP_001277403.1.90529 WP_001277403.1.90535 WP_001277403.1.90539 WP_001277403.1.90565 WP_001277403.1.90583 WP_001277403.1.90597 WP_001277403.1.90603 WP_001277403.1.90615 WP_001277403.1.90663 WP_001277403.1.90676 WP_001277403.1.90678 WP_001277403.1.90693 WP_001277403.1.907 WP_001277403.1.90727 WP_001277403.1.90731 WP_001277403.1.90733 WP_001277403.1.90762 WP_001277403.1.90768 WP_001277403.1.90776 WP_001277403.1.90778 WP_001277403.1.90805 WP_001277403.1.90869 WP_001277403.1.90882 WP_001277403.1.90897 WP_001277403.1.90925 WP_001277403.1.90927 WP_001277403.1.90942 WP_001277403.1.90970 WP_001277403.1.90980 WP_001277403.1.90989 WP_001277403.1.91037 WP_001277403.1.91041 WP_001277403.1.91052 WP_001277403.1.91057 WP_001277403.1.91058 WP_001277403.1.91079 WP_001277403.1.91099 WP_001277403.1.91127 WP_001277403.1.91129 WP_001277403.1.91149 WP_001277403.1.9115 WP_001277403.1.91154 WP_001277403.1.91193 WP_001277403.1.9124 WP_001277403.1.91269 WP_001277403.1.91276 WP_001277403.1.91321 WP_001277403.1.91358 WP_001277403.1.91369 WP_001277403.1.91375 WP_001277403.1.91388 WP_001277403.1.91413 WP_001277403.1.9146 WP_001277403.1.91478 WP_001277403.1.91481 WP_001277403.1.91562 WP_001277403.1.9162 WP_001277403.1.91650 WP_001277403.1.91686 WP_001277403.1.91718 WP_001277403.1.91808 WP_001277403.1.91811 WP_001277403.1.91815 WP_001277403.1.9184 WP_001277403.1.91858 WP_001277403.1.91878 WP_001277403.1.91888 WP_001277403.1.9192 WP_001277403.1.91923 WP_001277403.1.91927 WP_001277403.1.91960 WP_001277403.1.92015 WP_001277403.1.92027 WP_001277403.1.92032 WP_001277403.1.92045 WP_001277403.1.92103 WP_001277403.1.92116 WP_001277403.1.92176 WP_001277403.1.92177 WP_001277403.1.92182 WP_001277403.1.92245 WP_001277403.1.92248 WP_001277403.1.9225 WP_001277403.1.92298 WP_001277403.1.92353 WP_001277403.1.92355 WP_001277403.1.92369 WP_001277403.1.92381 WP_001277403.1.92386 WP_001277403.1.92389 WP_001277403.1.92400 WP_001277403.1.92487 WP_001277403.1.92491 WP_001277403.1.92564 WP_001277403.1.92631 WP_001277403.1.92640 WP_001277403.1.92724 WP_001277403.1.92740 WP_001277403.1.92755 WP_001277403.1.92814 WP_001277403.1.92835 WP_001277403.1.92837 WP_001277403.1.92850 WP_001277403.1.92854 WP_001277403.1.92866 WP_001277403.1.92874 WP_001277403.1.92906 WP_001277403.1.92913 WP_001277403.1.92940 WP_001277403.1.92967 WP_001277403.1.9299 WP_001277403.1.93021 WP_001277403.1.93075 WP_001277403.1.93084 WP_001277403.1.93096 WP_001277403.1.93108 WP_001277403.1.93129 WP_001277403.1.93158 WP_001277403.1.93173 WP_001277403.1.93178 WP_001277403.1.93202 WP_001277403.1.9326 WP_001277403.1.93274 WP_001277403.1.93347 WP_001277403.1.93361 WP_001277403.1.9339 WP_001277403.1.93401 WP_001277403.1.93404 WP_001277403.1.93452 WP_001277403.1.93475 WP_001277403.1.93479 WP_001277403.1.93496 WP_001277403.1.935 WP_001277403.1.93506 WP_001277403.1.93515 WP_001277403.1.93522 WP_001277403.1.93548 WP_001277403.1.93609 WP_001277403.1.93616 WP_001277403.1.9364 WP_001277403.1.93680 WP_001277403.1.93696 WP_001277403.1.93701 WP_001277403.1.93720 WP_001277403.1.93785 WP_001277403.1.93786 WP_001277403.1.93811 WP_001277403.1.93814 WP_001277403.1.93832 WP_001277403.1.93835 WP_001277403.1.93865 WP_001277403.1.93869 WP_001277403.1.93878 WP_001277403.1.93902 WP_001277403.1.93910 WP_001277403.1.93947 WP_001277403.1.93974 WP_001277403.1.93982 WP_001277403.1.93992 WP_001277403.1.94024 WP_001277403.1.94029 WP_001277403.1.94068 WP_001277403.1.94090 WP_001277403.1.94104 WP_001277403.1.94148 WP_001277403.1.94157 WP_001277403.1.94159 WP_001277403.1.94192 WP_001277403.1.94220 WP_001277403.1.94258 WP_001277403.1.94260 WP_001277403.1.94269 WP_001277403.1.94274 WP_001277403.1.943 WP_001277403.1.94330 WP_001277403.1.94334 WP_001277403.1.94357 WP_001277403.1.94368 WP_001277403.1.94391 WP_001277403.1.94395 WP_001277403.1.94425 WP_001277403.1.94442 WP_001277403.1.94459 WP_001277403.1.945 WP_001277403.1.94503 WP_001277403.1.94515 WP_001277403.1.94526 WP_001277403.1.94538 WP_001277403.1.94558 WP_001277403.1.94570 WP_001277403.1.94577 WP_001277403.1.9458 WP_001277403.1.94595 WP_001277403.1.94610 WP_001277403.1.94644 WP_001277403.1.94651 WP_001277403.1.94652 WP_001277403.1.94689 WP_001277403.1.94708 WP_001277403.1.94711 WP_001277403.1.94724 WP_001277403.1.94778 WP_001277403.1.9483 WP_001277403.1.94883 WP_001277403.1.94925 WP_001277403.1.94940 WP_001277403.1.95013 WP_001277403.1.95058 WP_001277403.1.95073 WP_001277403.1.95104 WP_001277403.1.95106 WP_001277403.1.95153 WP_001277403.1.95177 WP_001277403.1.95192 WP_001277403.1.95208 WP_001277403.1.95240 WP_001277403.1.95251 WP_001277403.1.95264 WP_001277403.1.953 WP_001277403.1.95303 WP_001277403.1.95321 WP_001277403.1.95334 WP_001277403.1.95356 WP_001277403.1.95369 WP_001277403.1.95413 WP_001277403.1.95458 WP_001277403.1.95468 WP_001277403.1.95528 WP_001277403.1.95531 WP_001277403.1.95553 WP_001277403.1.95583 WP_001277403.1.95621 WP_001277403.1.95642 WP_001277403.1.95692 WP_001277403.1.95722 WP_001277403.1.95725 WP_001277403.1.95732 WP_001277403.1.95736 WP_001277403.1.95738 WP_001277403.1.95740 WP_001277403.1.95762 WP_001277403.1.95807 WP_001277403.1.95853 WP_001277403.1.95868 WP_001277403.1.95870 WP_001277403.1.95904 WP_001277403.1.95925 WP_001277403.1.95933 WP_001277403.1.95942 WP_001277403.1.95992 WP_001277403.1.95998 WP_001277403.1.96007 WP_001277403.1.96011 WP_001277403.1.96012 WP_001277403.1.96016 WP_001277403.1.96024 WP_001277403.1.96049 WP_001277403.1.96100 WP_001277403.1.96109 WP_001277403.1.96120 WP_001277403.1.9615 WP_001277403.1.96178 WP_001277403.1.96181 WP_001277403.1.96189 WP_001277403.1.9620 WP_001277403.1.96205 WP_001277403.1.9621 WP_001277403.1.96244 WP_001277403.1.96292 WP_001277403.1.96309 WP_001277403.1.96321 WP_001277403.1.96421 WP_001277403.1.96432 WP_001277403.1.96436 WP_001277403.1.96448 WP_001277403.1.96466 WP_001277403.1.96487 WP_001277403.1.96499 WP_001277403.1.96517 WP_001277403.1.96595 WP_001277403.1.966 WP_001277403.1.96619 WP_001277403.1.9662 WP_001277403.1.96629 WP_001277403.1.96636 WP_001277403.1.96652 WP_001277403.1.96709 WP_001277403.1.96728 WP_001277403.1.96785 WP_001277403.1.96791 WP_001277403.1.96812 WP_001277403.1.96819 WP_001277403.1.96858 WP_001277403.1.96872 WP_001277403.1.96873 WP_001277403.1.96901 WP_001277403.1.96958 WP_001277403.1.96974 WP_001277403.1.96994 WP_001277403.1.97046 WP_001277403.1.97073 WP_001277403.1.97091 WP_001277403.1.971 WP_001277403.1.9712 WP_001277403.1.97158 WP_001277403.1.97182 WP_001277403.1.972 WP_001277403.1.97254 WP_001277403.1.97265 WP_001277403.1.9727 WP_001277403.1.97284 WP_001277403.1.97362 WP_001277403.1.97383 WP_001277403.1.97410 WP_001277403.1.97436 WP_001277403.1.97442 WP_001277403.1.97479 WP_001277403.1.97482 WP_001277403.1.97524 WP_001277403.1.97526 WP_001277403.1.97543 WP_001277403.1.97595 WP_001277403.1.97610 WP_001277403.1.97657 WP_001277403.1.97702 WP_001277403.1.97733 WP_001277403.1.97738 WP_001277403.1.97804 WP_001277403.1.97810 WP_001277403.1.97824 WP_001277403.1.97831 WP_001277403.1.97856 WP_001277403.1.97878 WP_001277403.1.97879 WP_001277403.1.97880 WP_001277403.1.97891 WP_001277403.1.97901 WP_001277403.1.97921 WP_001277403.1.97931 WP_001277403.1.97980 WP_001277403.1.97994 WP_001277403.1.98044 WP_001277403.1.98045 WP_001277403.1.98049 WP_001277403.1.98057 WP_001277403.1.98074 WP_001277403.1.98084 WP_001277403.1.98094 WP_001277403.1.98159 WP_001277403.1.98168 WP_001277403.1.9819 WP_001277403.1.98196 WP_001277403.1.98217 WP_001277403.1.98259 WP_001277403.1.98273 WP_001277403.1.98277 WP_001277403.1.98286 WP_001277403.1.98288 WP_001277403.1.98290 WP_001277403.1.98319 WP_001277403.1.98427 WP_001277403.1.98428 WP_001277403.1.98435 WP_001277403.1.98449 WP_001277403.1.98460 WP_001277403.1.98504 WP_001277403.1.98539 WP_001277403.1.98589 WP_001277403.1.98623 WP_001277403.1.98632 WP_001277403.1.98635 WP_001277403.1.98648 WP_001277403.1.98679 WP_001277403.1.98711 WP_001277403.1.98732 WP_001277403.1.98747 WP_001277403.1.98755 WP_001277403.1.98759 WP_001277403.1.98771 WP_001277403.1.98781 WP_001277403.1.98787 WP_001277403.1.98855 WP_001277403.1.98862 WP_001277403.1.98879 WP_001277403.1.98893 WP_001277403.1.98905 WP_001277403.1.98934 WP_001277403.1.98989 WP_001277403.1.99001 WP_001277403.1.99034 WP_001277403.1.99096 WP_001277403.1.99114 WP_001277403.1.99126 WP_001277403.1.99138 WP_001277403.1.99148 WP_001277403.1.99181 WP_001277403.1.99202 WP_001277403.1.99203 WP_001277403.1.99223 WP_001277403.1.99301 WP_001277403.1.99313 WP_001277403.1.99329 WP_001277403.1.99342 WP_001277403.1.99362 WP_001277403.1.99364 WP_001277403.1.99371 WP_001277403.1.99382 WP_001277403.1.99387 WP_001277403.1.99436 WP_001277403.1.99502 WP_001277403.1.99547 WP_001277403.1.99554 WP_001277403.1.99557 WP_001277403.1.99593 WP_001277403.1.99606 WP_001277403.1.99624 WP_001277403.1.99628 WP_001277403.1.99649 WP_001277403.1.99669 WP_001277403.1.99687 WP_001277403.1.9969 WP_001277403.1.997 WP_001277403.1.99732 WP_001277403.1.99760 WP_001277403.1.99787 WP_001277403.1.99793 WP_001277403.1.9984 WP_001277403.1.99879 WP_001277403.1.99900 gi|480535196|ref|YP_007813106.1| gi|480532571|ref|YP_007764774.1| gi|387757794|ref|YP_006064773.1| gi|480537020|ref|YP_007814929.1| gi|298503290|ref|YP_003725230.1| gi|194398508|ref|YP_002038184.1| gi|225861385|ref|YP_002742894.1| gi|480531576|ref|YP_007763780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]